KEGG   Streptomyces sp. SirexAA-E: SACTE_6447Help
Entry
SACTE_6447        CDS       T01601                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00071  Fatty acid degradation
ssx00280  Valine, leucine and isoleucine degradation
ssx00281  Geraniol degradation
ssx00310  Lysine degradation
ssx00360  Phenylalanine metabolism
ssx00362  Benzoate degradation
ssx00380  Tryptophan metabolism
ssx00410  beta-Alanine metabolism
ssx00627  Aminobenzoate degradation
ssx00640  Propanoate metabolism
ssx00650  Butanoate metabolism
ssx00903  Limonene and pinene degradation
ssx00930  Caprolactam degradation
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01212  Fatty acid metabolism
Module
ssx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SACTE_6447
   00650 Butanoate metabolism
    SACTE_6447
  Lipid metabolism
   00071 Fatty acid degradation
    SACTE_6447
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACTE_6447
   00310 Lysine degradation
    SACTE_6447
   00360 Phenylalanine metabolism
    SACTE_6447
   00380 Tryptophan metabolism
    SACTE_6447
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACTE_6447
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACTE_6447
   00281 Geraniol degradation
    SACTE_6447
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACTE_6447
   00627 Aminobenzoate degradation
    SACTE_6447
   00930 Caprolactam degradation
    SACTE_6447
Enzymes [BR:ssx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACTE_6447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEN14215
UniProt: G2NK33
Position
7299417..7300481
Genome map
AA seq 354 aa AA seqDB search
MNDDESVLLHTEGHTLHITLNRPRALNALTHTMVRSIDEALTQAEADASVVAVVISGAGE
RGLCAGGDIRSIYQDARAGRRASVDFWRDEYLLNARIARFPKPYVALMDGIVMGGGVGVS
AHGDVRVVTERSRVAMPETGIGFVPDVGGTHLLGAAPGELGTHLALTGRPVNAADALACG
LADHFVPSARLSDLVEALSRCTAPADVPETVRRYGGTAPAPELAEHRAWIDDCYAADTVE
EIIDRLAHTGLPAAEETARSLRTLSPTSLKVTLEAVRRARRLGGLEAALDQEFRVSCRAF
EGHDLVEGVRARIIDKDRAPKWNPAQLGDVTEADVARHFEPLGAGELGLHAAAS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgacgagtccgtcctgctgcacaccgagggccacaccctgcacatcaccctc
aaccgccccagggcactgaacgccctcacccacaccatggtccggagcatcgacgaggcc
ctcacccaggccgaggccgacgcctcggtcgtcgccgtcgtgatcagcggcgccggcgaa
cgaggactctgcgcgggaggcgacatccgctcgatctaccaggacgcccgtgcgggccgg
cgcgcctccgtggacttctggcgcgacgagtacctgctgaacgcgcggatcgcccggttc
cccaagccgtacgtggcgctcatggacggcatcgtgatgggcggcggcgtcggcgtctcg
gcccacggtgacgtccgcgtcgtcaccgaacgctcccgcgtcgccatgcccgagaccggc
atcggcttcgtccccgacgtcggcggcacccatctgctcggcgccgcgcccggggagctc
ggtacccacctcgccctcaccggcaggccggtgaacgccgccgacgccctcgcgtgcggg
ctcgccgaccacttcgtcccctccgcccggctgtccgacctcgtcgaggcgctctcccgg
tgcaccgcacccgcggatgtgccggagacggtccggcggtacgggggtacggcacccgcc
ccggaactcgcggagcaccgcgcgtggatcgacgactgctacgccgcggacacggtcgag
gagatcatcgaccggctcgcacacaccgggttgccggcggccgaggagaccgcgcgctca
ctccggaccctgtcacccacctcgctcaaggtcaccctcgaagccgtgcgccgggcccgg
cggctcggagggctggaagcggcactggaccaggagttccgcgtctcctgccgcgccttc
gagggccacgacctggtggaaggggtgcgggcccgcatcatcgacaaggaccgtgccccc
aaatggaaccccgcgcagctcggtgacgtcaccgaggccgatgtcgcccgtcacttcgaa
ccgctcggagcgggagaactcggtctgcacgccgccgcctcctga

DBGET integrated database retrieval system