KEGG   Streptomyces sp. SirexAA-E: SACTE_6517Help
Entry
SACTE_6517        CDS       T01601                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SACTE_6517
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SACTE_6517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7370221..7372029
Genome map
AA seq 602 aa AA seqDB search
MTPTPQALLTYSEGTLLRAGRPHQVLAGTLHYFRVHPDQWHDRLERLAAMGLNTVDTYIA
WNFHERRTGEHRFDGWRDIERFVRTAQRTGLDVIVRPGPYICAEWDNGGLPAWLTDRPGM
RPRSSYAPYLDEVARWFDVLIPRIADLQAARGGPVVAVQVENEYGSYGDDHAYMRWVHDA
LAGRGVTELLYTADGPTELMLDGGSLPGVLATATLGSRADQAAQLLRTRRSGEPFLCAEF
WNGWFDHWGEKHHTRSVGSAAAALDEILAKGGSVSLYPAHGGTNFGLWAGANHADGALQP
TVTSYDSDAPIAEHGAPTPKFHAFRDRLLAATGAAERELPRSRPLLAPRSLPLTRGARLL
TALEAVSDTVASPHPLSFGQLGQSSGLVLYRAHPVLPPGASELTVTGLHDRAQVFVDGAA
VGVLERETASLTVEGTGRAVRLELLVENQGRINYGPLLGQGKGILGGVRVERRLVHHWTM
RSLPLDEWTADDLARATAAVGEAAPLGEAASGFATAQFDAEGSGDTFLAFPGSGKGFVWI
NDFLLGRYWNIGPQTTLYVPAPLVTPGANRLTLLELEGFGDHVELRTGPELGPPEEYIET
FS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacccccaccccgcaggccctgctgacctactcagagggcacgttgctacgggccggc
cgcccgcaccaggtcctcgccggtaccctgcactacttccgcgtccaccccgatcagtgg
cacgacaggctggaacgcctggcggccatgggcctgaacacggtggacacctacatcgcc
tggaacttccacgaacggcgcacgggggagcaccgcttcgacggctggcgggacatcgag
cgcttcgtgcgcacggcccagcggaccggcctcgacgtgatcgtccggcccggcccctac
atctgcgccgagtgggacaacggcggcctgcccgcctggctcaccgaccgccccggcatg
cggccacgttcgtcgtacgccccctacctggacgaggtcgcccgctggttcgacgtcctc
atccccaggatcgccgacctccaggcggcacgcggcggccccgtcgtcgccgtccaggtg
gagaacgagtacggaagctacggcgacgaccacgcctacatgcggtgggtgcacgacgcc
ctcgccggacggggcgtcaccgagctgctctacaccgccgacggacccaccgagctgatg
ctcgacggaggcagcctgccgggcgtcctcgccaccgccactctcgggtcccgcgccgac
caggccgcacaactgctgcgcacgcgccggagcggtgagccgttcctgtgcgcggaattc
tggaacggatggttcgaccactggggcgagaagcaccacacccgctccgtggggagcgcc
gccgcggccctggacgagatcctcgccaagggcggctcggtcagcctctaccccgcgcac
ggcggcaccaacttcggtctctgggcgggcgccaaccatgcggacggcgcgctccagccc
accgtcaccagctacgactcggacgcaccgatcgcggaacacggcgctcccacccccaag
ttccacgccttccgcgacagactgctggccgccacgggcgccgctgagcgtgaactgccc
cgctcacgacccctcctggccccccgctcgctgcccctgacccggggggcccgactgctc
acggctctggaagccgtctccgacaccgtcgcctcaccccaccccctgtccttcggacag
ctcggccagtcctccgggctcgtcctctaccgtgcccaccccgtgctcccgcccggagcg
agcgagctgaccgtgaccggcctgcacgaccgggcgcaggtcttcgtcgacggcgccgcc
gtcggcgtgctggaacgcgagaccgcctcactgaccgtggagggcaccgggcgggcggtc
cgcctggagctcctggtggagaaccaaggccgcatcaactacgggccgctcctgggacag
ggcaagggcatcctcggcggggtgcgcgtcgagcgccggctggtccaccactggacgatg
cgctccctgccgctcgacgaatggacggccgacgacctcgcacgggcgacggcggccgtg
ggggaggcggcacccttgggggaggcggcatccggcttcgccaccgcgcagttcgacgcg
gaggggagcggcgacaccttcctggccttcccgggctccggcaagggtttcgtatggatc
aacgacttcctgctcgggcggtactggaacatcggcccccagaccacgctctatgtgccg
gcgcccctcgtcacccccggcgccaaccgcctgaccctgctcgaactggaaggcttcggc
gaccacgtggagctccgcaccggcccggagctgggcccgcccgaggagtacatcgagacc
ttctcctga

DBGET integrated database retrieval system