KEGG   Sphingobium sp. SYK-6: SLG_00120Help
Entry
SLG_00120         CDS       T01622                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00010  Glycolysis / Gluconeogenesis
ssy00620  Pyruvate metabolism
ssy00640  Propanoate metabolism
ssy00680  Methane metabolism
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_00120 (acs)
   00620 Pyruvate metabolism
    SLG_00120 (acs)
   00640 Propanoate metabolism
    SLG_00120 (acs)
  Energy metabolism
   00680 Methane metabolism
    SLG_00120 (acs)
Enzymes [BR:ssy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SLG_00120 (acs)
Lipid biosynthesis proteins [BR:ssy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SLG_00120 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAK64687
NITE: SLG_00120
UniProt: G2IIK7
Position
7533..9476
Genome map
AA seq 647 aa AA seqDB search
MNQTVYPVPAEWRQRAYVDAEAYARLYAQSLSDPEGFWREQAQRLDWIRPFTQVKDTSFD
EADFGIRWFADGSLNIAANCLDRHLETQGDVPAILWAGDDPAESRTITYRELHEEVCRFA
NVLKAKGVRRGDRVTIYMPMIPEAAMAMLACARIGAIHSVVFAGFSPESLAGRVTDCDSS
VIITADEGLRGGRKIPLKANVDEALGHCTACATVIVVRRTGGPVTMVPGRDYWYHELRES
VPADCPAVEMGAEDPLFILYTSGSTGKPKGVLHTTGGYLLWAALTHHVVFDYKPGEIYWC
AADIGWVTGHSYIVYGPLANGATTVMFEGVPSYPDFSRFWQVVDQFGVNIFYTAPTAIRA
LMREGDEWVRKSSRSSLRLLGSVGEPINPEAWEWYYSVVGERRCPIMDTWWQTETGGHMI
TPLPGAIPLKPGSASRPFFGVQPQVVDPEGHVLEGAVEGNLVIADSWPGQMRTVWGDHER
FFQTYFSTYPGKYFTGDGCRRDADGDYWITGRVDDVINVSGHRMGTAEVESALVAHAKVA
EAAVVGMPHDIKGQGIYAYVTLNANEEGDDALRAELVRWVRHEIGPIATPDVIQFAPALP
KTRSGKIMRRILRKIAENAVDQLGDISALADPGVVDHLVANRHRAIA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcagaccgtttatcccgttcccgccgaatggcgtcaaagagcctatgtcgacgcg
gaggcctatgcccgcctctatgcgcagtccctcagcgatccggagggcttctggcgggag
caggcgcagcggctggactggatacggcccttcacgcaggtgaaggatacgagtttcgac
gaggccgatttcggcatccgctggttcgcggacggcagtttgaacatcgccgcgaattgc
ctcgatcgccatctggagacgcagggcgatgtgccggccatcctctgggcaggcgacgat
ccggccgagagccgcaccatcacctatcgcgagctccatgaggaagtctgccgcttcgcc
aatgtgctgaaggccaagggtgtccgcaggggcgatcgcgtcaccatctacatgccgatg
attcccgaggcggcgatggcgatgctggcctgcgcgcgcattggcgccattcatagcgtg
gtgttcgccggcttctcgccggagagcttggcgggacgcgtcacggattgcgattcgagc
gtcatcatcacggccgacgagggtctgcgcggtgggcggaagatcccgctcaaggccaat
gtcgacgaggcgctcggccattgcacggcgtgcgcgacggtcatcgtcgtgcggcgcacc
ggcggcccggtgaccatggtgcccggccgggactactggtatcatgagttgcgcgagagc
gtgccggcggattgcccggccgtggagatgggtgcggaagacccgctgttcattctctac
acgtccgggtccaccggaaagcccaagggcgtgctgcacacgacgggcggctatctgctc
tgggcggcgctcacccatcatgtcgtgttcgattacaagccgggcgagatctactggtgc
gcggcggacatcggctgggtcacggggcacagctacatcgtctacggcccgctcgccaac
ggcgcgacgacggtgatgttcgagggcgtccccagctaccccgatttcagccgcttctgg
caagtggtggaccagttcggggtgaacatcttctacaccgcgcccaccgcgatccgcgcg
ctcatgcgcgagggcgacgaatgggtccgcaagtccagccgcagctcgctgcgcctgctg
gggtcggtcggcgagccgatcaacccggaggcgtgggaatggtattattccgtcgtgggc
gagcgccggtgcccgatcatggacacatggtggcagacggagaccggcgggcacatgatc
accccgctgcccggcgccatcccgctcaagccgggcagtgcctcgcggcccttcttcggc
gtgcagccgcaggtcgtcgatccggaaggtcatgtcctggaaggcgcggtggaaggcaat
ctcgtcatcgcggacagctggccgggccagatgcgtacggtctggggcgatcatgagcgc
ttcttccagacctatttctcgacctatcccggcaaatatttcacgggggacggctgccgg
cgcgatgcggatggggattactggatcaccggccgcgtggacgacgtcatcaacgtctcg
ggccatcgcatgggcacggcggaagtcgagagcgcgctcgtcgctcatgccaaggtcgcc
gaggcggccgtcgtgggcatgccccacgacatcaagggccagggcatctatgcctatgtg
accttgaacgcgaacgaggaaggggatgatgccctgcgcgccgagctggtgcgctgggtg
cgccacgagatcggcccgatcgcgacaccggacgtcatccagttcgctcctgccctgccc
aagacccgctcgggcaagatcatgcgccgcatccttcgcaagatcgccgagaatgccgtg
gaccagctgggcgatatctccgcgctcgccgatccgggcgtggtcgatcatctcgtggcg
aaccggcatcgcgccatcgcctga

DBGET integrated database retrieval system