KEGG   Sphingobium sp. SYK-6: SLG_00290Help
Entry
SLG_00290         CDS       T01622                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SLG_00290 (ruvA)
Enzymes [BR:ssy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SLG_00290 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(28484..29101)
Genome map
AA seq 205 aa AA seqDB search
MIAHLKGLLVSTGADNAVVDVGGVGYLVGMSTRSLAALGRAGEHVMIHTEMLVGEEFIRL
VGFASEAERDWFRLLTSVQGVGARVALAILSVLDPNELHRAVAAQDKAMVARANGVGPKL
AERIVRELKDRTGTIASGPLPIGGGQGGIAPAAGSGVEADAMAALASLGFRPGEASLAVS
AALAELGEDVSLDRLVRLALRKAAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgcatctcaagggcctgctcgtctccaccggggcggataatgccgtcgtcgac
gtcggcggcgtgggctatctggtcggcatgtccacgcgcagcctcgccgccctcggccgg
gcgggcgagcatgtcatgatccataccgagatgctggtcggcgaagagttcatccggctg
gtgggctttgccagcgaagcggagcgggactggttccggctgctcaccagcgtgcagggt
gtcggcgcgcgagtcgcgctggccatcctctcggtgctcgaccccaatgagctgcatcgc
gccgtcgccgcgcaggacaaggcgatggtggcacgcgccaatggcgtgggccccaagctt
gccgagcgcatcgtgcgcgaactcaaggaccggacgggcacgatcgcgagcggtccgctg
cccatcggcggggggcagggcgggatcgcgccggcggccgggagcggcgtggaagccgac
gccatggccgcgctcgcatccctcggcttccggccgggcgaggcaagccttgcggtgagc
gcggcactggcggagctgggggaagacgtcagcctcgacaggctagtgcgactcgcgctg
cgcaaggccgcgaaatga

DBGET integrated database retrieval system