KEGG   Sphingobium sp. SYK-6: SLG_00380Help
Entry
SLG_00380         CDS       T01622                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssy01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ssy00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
34132..35280
Genome map
AA seq 382 aa AA seqDB search
MTPALTDPVALAEKLIACPSVTPATGAVFDCLEAMLRPLGFTVERFVDGDEAEGGPVENL
LAVRRSGDGPHFAFAGHLDVVPPGEGWTSDAFLPERRGDLLHGRGAVDMKGAIAAFVAAV
ARTPNAGGTISLLITGDEEGEAVHGTRALMRHMAARAVVPDLCLVGEPTSVGRLGDTIKI
GRRGSVNMWITVPGVQGHVAYPHLADNPIPRLIRILSAIEAIELDEGTDWFQPSNIEITD
LHVGNPATNVIPARAAARLSIRFNDLHRGEALVSRIAALVEAEGGTLQAKISGEAFLTPP
GPLSTLVSDAITAETGLVPELSTSGGTSDARFLSALCPVVEFGLLNATMHKLDEAVALPD
LEGLTRIYMRVLAAALSPAAAG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgctctcaccgatcccgtcgcgctggccgaaaagctgatcgcctgcccctcc
gtcacacccgccaccggcgcggtgttcgactgcctcgaggcgatgctgcggccgctgggc
ttcacggtcgagcgcttcgtcgatggcgacgaggcggaaggcgggccggtcgagaatctg
ctggccgtacgccgatcgggtgacgggccgcatttcgctttcgccggtcatctcgacgtg
gtgccgcccggcgagggctggacaagcgatgccttcctgcccgagcggcggggcgacctg
ctccacgggcgcggcgcggtggacatgaaaggggccatcgccgctttcgtcgccgccgtg
gcgcgcacgccgaacgctggcggcacgatcagcctgctcatcaccggcgacgaggaaggc
gaggcggtccacggcacccgcgcgctcatgcgccacatggccgcgcgggccgtggtgccg
gacctctgtctcgtcggggagccgaccagcgtcgggcggctgggcgacacgatcaagatc
gggcggcgcggatcggtcaacatgtggatcaccgtgcccggcgtgcagggccatgtcgct
tatccgcatctggccgacaatccgatcccgcgcctcatccgcatcctgtcggcgatcgag
gcgatcgagctggacgagggaacggactggttccagcccagcaacatcgagattaccgat
ctgcatgtcggcaatccggccacgaatgtcattcccgcccgggcggccgcgcgcctctcc
atccgcttcaatgatctgcatcgcggcgaggcactggtgtcgcggatcgcggcgctggtg
gaggcagagggcggcacattgcaggcgaagatcagcggcgaggcgttcctgaccccgccc
ggtccgctttccacgctggtgagcgacgccatcacggccgaaaccggccttgtcccggag
ctgtccaccagcggcggcacgtccgacgcccgctttctctccgcgctgtgcccggtcgtc
gagttcggcctcctcaacgcgacgatgcacaagctggacgaagcggtggccctgccggac
cttgaaggcctcacccgcatctacatgcgcgtgctcgctgccgcgctcagcccggccgcc
gcaggatga

DBGET integrated database retrieval system