KEGG   Sphingobium sp. SYK-6: SLG_00510Help
Entry
SLG_00510         CDS       T01622                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SLG_00510
Enzymes [BR:ssy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SLG_00510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
47111..47794
Genome map
AA seq 227 aa AA seqDB search
MKRPLVLLRPQPGNDASAKRARALGMDVIQIPLFEIAPTPATALPDGPFDALLVTSINGA
RHGEAVLRQFADLPVFTVGDASAQAVRDAGGQIVITGQGDAASTIPLIRAAGHGRVLHLC
GDHVRPFDAMGIDVVRHVVYCSEARDMRPFAKLLATLPPSVIAVHSPRAGRRLNALMPPP
CRNHVLLAISEAAAKDSGGGWRQVHVSPAPDDTALLRLATSLCMGTS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcccgctcgtgctgttgcgcccgcagccgggcaacgatgcctcggccaaacgc
gcgcgggcgcttggcatggacgtcatacagatccccctgttcgagattgcgcccacgccg
gccaccgcgttgccggacgggcctttcgacgcgctgctggtcaccagcatcaatggcgcg
cgtcatggggaggccgtgctgcgccagttcgcggacctgcccgtcttcactgtcggtgac
gcgagcgcgcaggccgtgcgggacgcgggcgggcagatcgtcatcacgggccagggcgat
gccgcctcgacaatccctctcatccgggcggcggggcatggccgggttctgcatctgtgc
ggggaccatgtccggccgttcgatgcgatggggatcgatgtcgtccgccatgtcgtctat
tgcagcgaggcacgcgacatgcgccccttcgcgaagctgctcgcgacgttgccgcccagc
gtgatcgccgtgcattcgccgcgcgcgggacggcggctcaatgccctgatgccgccgccc
tgccgcaaccatgtcctgctcgccatcagcgaggcggcggcgaaggacagcggcgggggc
tggcgacaggtccatgtcagcccggctccggacgatacggccttgctgcgcctcgcaacc
tcgctatgtatgggcacttcttga

DBGET integrated database retrieval system