KEGG   Sphingobium sp. SYK-6: SLG_00740Help
Entry
SLG_00740         CDS       T01622                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:ssy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ssy00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ssy00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
71393..72667
Genome map
AA seq 424 aa AA seqDB search
MATEVKVPTLGESVTEATVGQWLKKPGEAVKADEPIASLETDKVAIEVPSPVSGVLGELL
VKEGDTVNVGAVIATIEDGGAPAAKAASAAPAPAKAEAAPAPAATPAPAAPAPAAAPAAE
SESASGPITLSPAVRRLVLEHGLDPSRITGTGKDGRLTKDDVLAAIAAGTAVAAAPAGAS
PAAAAAPASGPSREQERVKMTRLRQTVARRLKEAQNNAAILTTFNDVDMTAVIEARAKYK
DLFEKKHGIRLGFMGFFVKAACMALKDIPGVNAQIEGDEIVYNNFCDISVAVSAPNGLMV
PVIRNAESMSIAEIEKTIADFGKRAKEGSLSMADMAGGTFTISNGGVFGSLLSTPIINPP
QSGVLGLHRIEERPVVRNGQIVARPMMYLALSYDHRLIDGREAVTFLVAMKNAIEDPTRL
LIDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtgaaagtgcccacgctgggcgaatcggtcaccgaggcgaccgtcggc
cagtggctgaagaagcccggcgaagccgtgaaggccgacgaaccgatcgcgagcctggaa
acggacaaggtcgccatcgaggtgccttcgcccgtgagcggcgtgctcggtgaactgctc
gtcaaggaaggcgacaccgtgaatgtcggcgcggtcatcgcgacgatcgaggacggcggg
gccccggcggccaaggccgccagcgcagcgccggccccggcgaaggccgaagcagcgcct
gcgcctgcagcaacgcctgcgcccgcagcaccggcacccgccgccgcccccgcggcggaa
tccgagagcgcatccgggccgatcacgctgtcgcccgccgtgcgccgtctcgtcctcgag
catggcctcgaccccagccggatcaccggcaccggcaaggatggccgcctgaccaaggat
gacgtgctcgcggccatcgccgccggcaccgccgtcgcggctgcccccgcgggcgccagc
ccggccgcggccgctgcgccggcctccggtccttcccgcgagcaggagcgcgtgaagatg
acgcgcctgcgccagaccgtcgcccggcgactgaaggaagcgcagaacaacgccgccatt
ctcacgaccttcaacgatgtcgacatgaccgccgtcatcgaggcgcgcgcgaagtacaag
gacctgttcgagaagaagcacggcatccgcctcggcttcatgggcttcttcgtgaaggcc
gcgtgcatggcgctcaaggacattccgggcgtcaacgcgcagatcgagggcgacgagatc
gtctacaataatttctgcgacatctcggtcgcggtttccgcgcccaatggcctcatggtg
ccggtgatccgcaatgccgagagcatgagcatcgcggagatcgaaaagacgatcgccgat
ttcggcaagcgcgccaaggaaggctcgctttccatggcggacatggccggcggcactttc
accatctccaatggcggcgtgttcggcagcctgctgtccacgcccatcatcaatccgccc
cagtccggcgtgctcggcctgcaccgcatcgaggagcgcccggtcgtcaggaacggccag
atcgtggcgcggccgatgatgtatctggcgctgagctacgaccatcgcctgattgacggg
cgcgaggccgtgaccttccttgtcgcgatgaagaatgcgatcgaggatcccacccggctg
ctgatcgacttgtaa

DBGET integrated database retrieval system