KEGG   Sphingobium sp. SYK-6: SLG_01200Help
Entry
SLG_01200         CDS       T01622                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SLG_01200
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SLG_01200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
118024..118653
Genome map
AA seq 209 aa AA seqDB search
MSDRFNTIAGWALFAGIIALGSGIISSKLFHGERPEPMGYAIEGVEAEGAGGASGPSLNT
LLASADVAAGEKVFAKCVACHTINQGGANGIGPNLWGVVGEEIAHGRGGFAFSNALKEVG
GSWTFEQLDHWLASPRAFANGTKMSFAGLSKPEDRANVIAYMNAQGTNLPLPAADAEAAP
AEGDNAAAPAEGENAAAPAEAGNAAAPAE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgtttcaacaccattgcgggctgggcgctgttcgccggcatcattgcgctg
ggcagtggcatcatcagcagcaagctgttccacggcgagcggcccgagccgatgggctac
gctatcgagggcgtcgaggcagaaggcgccggcggtgcctccgggccgtcgctcaacacg
ctgctcgcgagcgccgacgttgcggccggcgaaaaggttttcgccaagtgcgtggcctgc
cacacgatcaatcagggtggcgccaacggcatcggtcccaatctctggggcgtggtcggc
gaggaaattgctcacggtcgcggtggcttcgccttctccaacgcgctcaaggaagtgggc
ggaagctggacattcgaacagctcgatcattggctggcctctccccgggcattcgccaat
ggcacgaagatgagctttgccggtctcagcaagccggaagaccgggcgaatgtcatcgcc
tacatgaatgcgcagggcaccaacctgccgctcccggctgccgatgccgaagcagctccg
gcagaaggcgacaacgcagcggcgcccgccgaaggcgagaatgccgcagcacctgctgaa
gccgggaacgccgccgcgccggccgagtaa

DBGET integrated database retrieval system