KEGG   Sphingobium sp. SYK-6: SLG_02070Help
Entry
SLG_02070         CDS       T01622                                 

Gene name
glsA
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ssy00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ssy00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ssy00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(214238..215173)
Genome map
AA seq 311 aa AA seqDB search
MTPNLQAIVDEIVAAMAAETERGAPARYIPGLAGISTDRFGMAVVTADGATAMGGDAEMP
FSIQSISKVFALTMALGKIGDQLWRRVGREPSGNAFNSIVQLEAEHGIPRNPFINAGAIV
VADVNLSGHMPRESIGELLRFVRFLADDETIVVDEAIARGEAETGYRNIALANYMRAFGN
IHHSVELVLGCYFHQCAIAMSCLQLAMAGRFLMLDGMQPGAGRVISPRRARRINALMLTC
GHYDASGDFAFRIGMPGKSGVGGGILAVVPGKASIAVWSPGLNASGNSQLGTLALERLAE
ATGWSIFRARA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaaatctgcaggccatagtcgacgagatcgtcgccgccatggcggccgagacg
gagcgaggcgcgccggcccgctacattcccggccttgcgggcatatccaccgaccggttc
ggcatggccgtcgtcacggccgatggcgcgaccgcgatgggcggcgacgcggaaatgcct
ttctccatccagtccatctccaaggtgttcgcgctcaccatggcgctgggcaagatcggc
gaccagctctggcgccgggtcggacgggagccctcgggcaatgccttcaattcgatcgtc
cagctcgaggcggagcacggcattccgcgcaaccccttcatcaatgccggggcgatcgtc
gtcgcggacgtcaatctctccggacacatgccgcgggagtcgataggcgagctgctgcgc
ttcgtgcgcttcctcgcggatgacgagacgatcgtggtggatgaggccatcgcgcgcggg
gaagccgagacaggctatcgcaacatcgccctcgccaattacatgcgcgccttcggcaat
atccatcattccgtcgagctggtgctgggctgctacttccaccagtgcgccatcgcgatg
agttgcctccagctcgccatggcgggccgcttcctgatgctggacggcatgcagcccggc
gccggccgcgtgatctccccacgccgcgcgcggcgcatcaatgcgctcatgctcacgtgc
ggccattatgacgccagcggagacttcgccttccgcatcggcatgccgggcaaatccggc
gtcggcggcggcatcctcgcggtggtgccgggcaaggcgagcatcgccgtctggtcgccc
ggactgaacgcgagcggaaactcccaactgggcacgctggcgctcgaaagactggccgaa
gcgactggctggagcatattcagggcacgggcctga

DBGET integrated database retrieval system