KEGG   Sphingobium sp. SYK-6: SLG_02210Help
Entry
SLG_02210         CDS       T01622                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLG_02210 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLG_02210 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    SLG_02210 (glcB)
Enzymes [BR:ssy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SLG_02210 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
229486..231588
Genome map
AA seq 700 aa AA seqDB search
MTKMVERAGLSVAADLAAFIETQVLPGTDIPADAFWAGTAGIFAQYAPRNRALLATRDNM
QAQIDAWHAARAGKPLDQAEYEGFLREIGYLVPEPAPFTIGTKDVDPELAVLAGPQLVVP
VLNARFLLNAANARWGSLYDALYGTDALPGAPAGKGYDPARGAQVIGWVKAFLDEAVPLA
SGSWADWTGQGDPDLADPTQLAGWSGDNILLAHHGLHIELVIDRTHPIGKDDPAGIADIL
LESALSTIVDLEDSVAAVDAEDKVAAYANWLGLMKGDLTATFEKSGHSMTRALEADRRYD
GRDGEELLLKGRSLLFVRNVGHLMTTPAVRLHDGSEAPEGILDGIVTSLIALHDVRGLGT
FRNSTTGSIYIVKPKMHGPEECAFTNDLFDAIEDLLGLGRHQLKVGVMDEERRTSANLAA
CIRAVKDRVVFINTGFLDRTGDEIHTSMRAGPMIRKGDMKTSDWIKAYEDRNVQIGLACG
FSGRAQIGKGMWAAPDRMADMLEQKIGHPMTGANTAWVPSPTAATLHATHYHRVDVHARQ
EARAKEAPASLGALLSIPLAHGVNWSEQEVREELENNAQGILGYVVRWVDQGIGCSKVPD
INDVGLMEDRATLRISSQHIANWLLHGVCSEAQVNAAFEKMAAKVDAQNAGDPLYRPMAG
HPESIALQAARALVFEGVSQPSGYTEPLLHAYRAKAKAQT
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagatggttgagcgtgccggcctgtcggtggctgcggatctggcggccttcatc
gagacgcaggtgctgccgggaacagacattcccgccgacgccttctgggccggcacggcg
ggcatcttcgcgcaatatgcgccgcgcaaccgggcgctgctcgccacgcgcgacaatatg
caggcccagatcgacgcctggcacgccgcgcgcgccggcaagccgctggatcaggcggaa
tatgagggcttcctgcgcgagatcggttatctggtcccggaaccggcgcccttcaccatc
ggcacgaaggatgtcgacccggagctggcggtgctcgccggcccccagctggtcgtgccc
gtgctcaatgcccgtttcctgctcaatgccgccaatgcgcgctggggcagcctgtatgac
gctctctacggcaccgatgccttgccgggcgcgcccgccggcaagggctacgatcccgcg
cggggggcgcaggtcataggctgggtgaaggcctttctcgacgaggcggtgccgctcgcc
agcggctcatgggcggactggaccgggcagggcgatcctgatctcgccgatccgacccag
cttgccggctggtccggcgacaacatcctgctggcccatcatggcctgcacatcgagctg
gtgatcgaccgcacccacccgatcggcaaggatgatcccgccggcatcgcggacatcctc
ctggaatcggcgctgtccaccatcgtcgatcttgaggattcggtggccgcggtggacgcc
gaggacaaggtcgcagcttatgcgaactggctcggcctgatgaagggcgatctcaccgcg
acattcgagaagagcggacacagcatgacccgcgcgctcgaggccgaccgccgctacgac
ggccgggacggcgaggaattgctgctcaagggccgcagcctgctgttcgtgcgcaatgtc
ggccacctcatgaccacgccggcggtgcggctgcacgatggcagcgaggcaccggaaggc
atattggacggcatcgtcaccagcctgatcgccctgcacgacgtgcggggcctcggcacg
ttccgcaacagcacgaccggcagcatctatatcgtcaagcccaagatgcacgggccggag
gagtgcgccttcaccaacgacctgttcgatgcgatcgaggatcttctgggcctcggccgc
caccagctcaaggtcggcgtgatggatgaggagcgccgcacctctgccaatctcgcggcc
tgcatccgtgcggtgaaggaccgggtggtgttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacatcgatgcgggccggtccgatgatccgcaagggcgacatgaag
acgtccgactggatcaaggcctatgaggaccgcaacgtacagatcggccttgcctgcggt
ttctcgggccgcgcgcagatcggcaagggcatgtgggcagcgcccgaccggatggcggac
atgcttgagcagaagatcggccacccgatgacaggcgccaacacggcatgggtgccctcg
cccaccgccgcgacgctccatgccacgcattatcaccgcgtcgacgtgcatgcccggcag
gaagcccgggcgaaggaagcgccggcatcgctgggcgccttgctcagcattccgctggcg
catggcgtcaactggtccgagcaggaagtgcgcgaggagctggagaacaatgcgcagggc
atactgggctatgtcgtgcgctgggtcgatcagggcatcggctgttccaaggtgccggac
atcaatgatgtcgggctgatggaggaccgcgcgacgctgcgcatctcttcccagcatatc
gccaactggctgctgcacggcgtgtgcagcgaggcgcaggtcaacgcggcgttcgagaag
atggcggccaaggtggatgcccagaatgcgggcgatccgctttaccggccgatggcgggc
catcccgagagcatcgcgctgcaggcggcgcgcgcgctggtgttcgagggcgtgtcgcag
cccagcggctataccgagccactgctgcatgcctatcgcgcgaaggcgaaggcacagacc
tga

DBGET integrated database retrieval system