KEGG   Sphingobium sp. SYK-6: SLG_03610Help
Entry
SLG_03610         CDS       T01622                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SLG_03610
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SLG_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(367526..368071)
Genome map
AA seq 181 aa AA seqDB search
MGLLLFLAACGSQPEPAGNAVAVPDAPVSEAPDNVAGEPAPANVTQPEAQPTPAATATPA
AAAAPAAPEPTPAAPVETAAGGDAANGAKLYAQCKICHALEPGKHGLGPSLHGVVGRKAA
SLPDFNYSPAMKASGKVWTNATLSDYLRAPMKVVPGTKMAFAGVANDKNRADIIAYLDTL
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggactgcttctctttctcgccgcctgcggcagccagccggaaccggccggcaatgcc
gtggccgtgcctgacgccccggtcagcgaagcgcccgacaatgtcgctggcgagcccgcg
cctgccaatgtgacgcagcccgaagcccagccgactccggccgccaccgccacgccggcc
gctgccgctgcgccggccgcacccgagcccacgccggctgccccggtggagaccgccgct
ggcggagacgcagccaatggcgcgaagctctatgcccagtgcaagatctgccacgcgctc
gaaccgggcaagcacggcctcgggccctcgctgcatggcgtggtcgggcgcaaggccgcg
tccctgcccgacttcaattattccccggcgatgaaggccagtgggaaggtgtggaccaac
gccactctctccgattatctgcgcgctccgatgaaagtggtgcccggcaccaagatggca
ttcgccggcgtcgccaacgacaagaaccgcgccgacatcatcgcttatctcgatacgctg
aaataa

DBGET integrated database retrieval system