KEGG   Sphingobium sp. SYK-6: SLG_05370Help
Entry
SLG_05370         CDS       T01622                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLG_05370 (gpm)
   01230 Biosynthesis of amino acids
    SLG_05370 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_05370 (gpm)
  Energy metabolism
   00680 Methane metabolism
    SLG_05370 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLG_05370 (gpm)
Enzymes [BR:ssy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SLG_05370 (gpm)
Exosome [BR:ssy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SLG_05370 (gpm)
  Exosomal proteins of melanoma cells
   SLG_05370 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
558709..559395
Genome map
AA seq 228 aa AA seqDB search
MPTLVLIRHGQSAWNLENRFTGWWDVDVTEKGAAEATAAGALMKEKGLDFDQCFTSLQKR
AIKTLHLALEEMDRLWLPVEKDWRLNERHYGGLTGLDKAETAAKHGDAQVKIWRRSFDVP
PPPLEAGSEYDLSKDRRYAGIDIPATESLKDTIARVLPYWESRIAPELKAGKRVLISAHG
NSLRALVKHLSNIPDDEITGLEIPTGQPIVYDLADDLTALDRYYLSER
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcttgtcctcatccgccatggccagtccgcctggaacctggagaaccgcttc
accggctggtgggatgtggacgtgacggagaagggcgcggcggaagcgacggcggcaggc
gcgctgatgaaggagaaggggctggatttcgaccagtgcttcacctcgctgcagaagcgg
gcgatcaagacgctccatctcgcgctggaggaaatggaccggctctggctgccggtggag
aaggactggcgcctcaacgagcggcattatggcggcctcaccgggctcgacaaggcggag
acggcggccaagcatggcgacgcgcaggtgaagatctggcgccgcagcttcgacgtgccg
ccgccgccgctggaagcgggcagcgaatatgatctctcgaaggaccggcgctatgcgggc
atcgacattcccgcgacggaaagcctcaaggataccatcgcgcgcgtgctgccttattgg
gagagccgcatcgcgccggagctgaaggcgggcaagcgcgtgctcatctccgcccacggc
aattcgctgcgcgcgctggtcaagcatctctccaacattcccgatgacgagatcaccggg
ctggagatccccaccggccagcccatcgtctatgatctcgcggacgatctcacggcgctc
gaccgttattatctctccgagcgctga

DBGET integrated database retrieval system