KEGG   Sphingobium sp. SYK-6: SLG_06090Help
Entry
SLG_06090         CDS       T01622                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SLG_06090 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SLG_06090 (murA)
Enzymes [BR:ssy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SLG_06090 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(632751..634034)
Genome map
AA seq 427 aa AA seqDB search
MDRIVIRGGKPLSGRITISGAKNAALTLLPCALLTEEPLTLRNLPRLADVDSFGHLLNQL
GVSTTVEGSRQEDFGRVMTLRANRITSSVAPYDIVRKMRASIVVLGPLLARAGEATVSLP
GGCAIGNRPIDFHLQAFQTLGATIEMANGYVRALAPDGGLRGALISFPFPSVGATENALM
AASLASGETVIENAAREPEIVDLCGLLVAMGSEIEGIGTDRLVVHGKPRLYGTTYKVMPD
RIEAGSYACAAAITGGELELVGASSDDMHAILKGLRDAGVHIEESGRSLRVAANGRLKPL
TLSTAPHPGFPTDMQAQFMAMLALADGASVLTETIFENRYMHVPELTRMGADITVNGRTA
VVRGVPGLTGAPVMATDLRASMSLILAGLAAQGETIVNRVYHLDRGYERLEEKLSAVGAD
IERDSDG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtatcgtcattcgcggcggcaagccgctctccggcaggatcaccatctccggc
gcaaagaacgcagcgctcacgctgctgccctgcgcgctgctcaccgaggagccgctgacg
ctgcgcaacctgccgcggctggcggatgtcgacagcttcggccacctgctcaaccagctc
ggcgtctcgaccactgtcgagggctcgcggcaggaggatttcggccgggttatgacgctg
cgggcgaaccgcatcacgtccagcgtcgcgccttatgacatcgtgcgcaagatgcgcgcc
tccatcgtggtgctggggccgctgctcgcgcgcgcgggcgaagcgaccgtctcgctgccg
ggcggctgcgccatcggcaaccggccgatcgacttccacctccaggcgttccagacgctg
ggcgcgacgatcgagatggccaatggctatgtgcgcgcgctggcgccggacggcggcctg
cgcggcgcgctcatttccttccccttcccgtcggtcggcgccaccgagaacgcgctcatg
gccgcgtcgctcgccagcggcgagaccgtgatcgagaatgccgcgcgcgagccggagatc
gtggacctgtgcggcctgctcgtcgccatgggcagcgagatcgaggggatcggcacggac
cggctcgtggtccacggcaagccgcggctctacggcaccacctacaaagtgatgcccgac
cggatcgaggccggcagctatgcctgcgcggccgccatcaccggcggcgagctggagctg
gtcggcgcgagcagcgatgacatgcatgccatcctcaagggcctgcgcgacgcgggcgtg
catatcgaggaaagcggccggagcctgcgcgtggcagcgaatggacggctgaagccgctc
acgctctccaccgcgccgcaccccggcttcccgacggacatgcaggcgcagttcatggcg
atgctggcgctggcggacggcgcgagcgtgcttaccgagacgatcttcgagaaccgctac
atgcatgtgcccgaactgacgcgcatgggcgcggacatcacggtgaacggccgcacggca
gtcgtgcgcggggtgccgggcctcaccggcgcgcccgtgatggcgacggacctgcgcgcc
tcgatgagcctcattctcgcgggcctcgccgcgcagggcgagacgatcgtcaatcgcgtc
taccatctcgaccggggctatgagcggctggaggagaagctctccgccgtcggcgccgac
atcgagcgcgacagcgacggctga

DBGET integrated database retrieval system