KEGG   Sphingobium sp. SYK-6: SLG_06460Help
Entry
SLG_06460         CDS       T01622                                 

Definition
lysophospholipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SLG_06460
Enzymes [BR:ssy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SLG_06460
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SLG_06460
Lipid biosynthesis proteins [BR:ssy01004]
 Fatty acid synthase
  Component type
   SLG_06460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
671015..671677
Genome map
AA seq 220 aa AA seqDB search
MGCSPSQPSPEDAPVTNAAAAAGNVAAPAGAPVEDARLVVVFGDSLYAGYQLEREEGFAP
ALERDLAARGIAARVVNAGVSGDTSAGGRGRLAFVLDGLPRKPDLVVVGLGGNDMLRGLD
PEQTRANLEAILTDLKARGIRAMLTGMLAAPNMGSDYAARFNAIYPDLARAFDVPLYPFF
LDGVIGDRALMLADGIHPNAQGVTAVTGRVAPLVVQALGD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgggctgttcgccttcccagccgtcgcccgaggacgcgccggtcaccaatgccgccgcg
gccgcgggcaacgtcgcggcaccggcgggcgcgccggtggaggatgccaggctggtcgtc
gtgttcggcgacagcctctatgcgggctatcagctcgagcgagaggaaggcttcgccccg
gcgctggagcgtgatcttgccgcgcggggcatcgctgcgcgcgtggtcaatgccggcgtc
tcgggcgatacgagcgcgggcgggcgcgggcgcctcgccttcgtgctggatggattgccg
cgcaagcccgatctcgtggtcgtcgggctcggcgggaacgacatgctgcgcgggctcgat
cccgagcagacgcgcgccaatctggaagcgatcctcacggacctgaaggcgcggggcatt
cgcgccatgctgaccggcatgctggccgcgcccaacatgggcagcgattatgccgcgcgc
ttcaacgccatctatccggatctcgcgcgcgcgttcgacgtgccgctctatcccttcttc
ctcgatggcgtgatcggcgatcgggccctgatgctggcggacggcattcaccccaatgcg
cagggcgtgaccgccgtgaccggccgcgtggcaccgctggtcgtgcaggcgctgggcgac
tga

DBGET integrated database retrieval system