KEGG   Sphingobium sp. SYK-6: SLG_06520Help
Entry
SLG_06520         CDS       T01622                                 

Definition
biotin carboxyl carrier protein
Orthology
K02160  
acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLG_06520
   01212 Fatty acid metabolism
    SLG_06520
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLG_06520
   00640 Propanoate metabolism
    SLG_06520
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SLG_06520
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    SLG_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(677329..677814)
Genome map
AA seq 161 aa AA seqDB search
MSLTAKDVEEIMKLLEGSTFDRLSLEMDGIRLELERGGAGATRPARATGAAPASPAESAP
APAPAPAAPPPAAARPEREAGLVEINAPLLGIFYHAPKPGEAPFVDVGSRVDTETVIGII
EVMKLMNSVSAGVSGEVVEIIGRNGELVEHGEVLMLVRPDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcacggcaaaggatgtcgaggagatcatgaagctcctcgaaggctcgacgttc
gaccggctgagccttgaaatggacggcatcaggctggagctggagcgcggcggcgcgggc
gcgacgcgaccggcgcgcgcaaccggcgccgcgcccgcatcgcctgcggaaagcgcgccg
gcaccagcccccgccccggcggcgccaccgcccgctgccgctcgcccggagcgcgaggcg
ggactggtggaaatcaacgcaccgctgctcggcatcttctaccacgcccccaagcccggc
gaagcgcccttcgtggatgtcggcagccgcgtcgacacggaaacggtgatcggcatcatc
gaggtgatgaagctcatgaactccgtctccgccggggtcagcggcgaagtcgtcgagatc
atcggccgcaatggcgagctggtggagcatggcgaagtgctgatgctcgtgcggccggac
gcctga

DBGET integrated database retrieval system