KEGG   Sphingobium sp. SYK-6: SLG_09310Help
Entry
SLG_09310         CDS       T01622                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00630  Glyoxylate and dicarboxylate metabolism
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01200  Carbon metabolism
Module
ssy_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SLG_09310
Enzymes [BR:ssy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SLG_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAK65606
NITE: SLG_09310
UniProt: G2INW7
Position
complement(987672..989267)
Genome map
AA seq 531 aa AA seqDB search
MTYHAEIERLTDSIALQGPGWAAIDPESAARMRAQNRFRTGLDIARYTAGIMRRDMAAYD
LDPGNYTQSLGCWHGFIGQQKLIAIKKHFGSTRGRYLYLSGWMIAALRSEFGPLPDQSMH
EKTSVPALIAELYTFLRQADARELGGLFRALDDAKRTHNQLDEMRLINAIETHETHVVPI
IADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKVTVPHEDFLQKIR
AIRYAFLELGVEDGIIVARTDSLGAGLTKQIAYSREPGDLGDQYNGFLDCEDIDPADVGN
GEVFISRAGKLLRPKRLPSNLYQFRPGTGEDRCVLDSITALRNGADLLWIETEKPHIGQI
AGMMDRIRAVIPNAKLVYNNSPSFNWTLNFRQQVFDAWEAEGRDVSAYDRAKLMSADYDG
TALASEADERIRTFQRDASARAGIFHHLITLPTYHTAALSTDNLARDYFGEQGMLGYVAG
VQRREIREGIACVKHQAMAGSDIGDDHKDYFAGDAALKAGGGANTMNQFAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcatgcagagattgagcggctgacggacagcattgccctgcagggccctggc
tgggccgcgatcgatcctgaatccgccgcacggatgcgcgcgcagaaccgctttcgcacc
gggctggacatcgcccgctacaccgccggcatcatgcgccgcgacatggcggcctatgat
ctggaccccggcaattacacccagtcgctgggctgctggcatggcttcatcgggcagcag
aagctgatcgccatcaagaagcatttcggcagcacgcgcgggcgctatctctatctctcg
ggctggatgatcgcggccctgcgcagcgaattcggcccgctgccggaccagtccatgcac
gagaagaccagcgtccccgctctgatcgcggaactctacaccttcctgcggcaggccgat
gcccgcgagctgggcggcctgttccgcgcgctggacgacgccaagcgcacgcataaccag
ctcgacgagatgcgcctcatcaatgccatcgagacacacgagacgcatgtcgtacccatc
atcgcggacatcgatgccgggttcggcaatgccgaggcgacttatctgctggccaagaag
atgatcgaggcgggcgcctgcgcgctccagatcgagaaccaggtctccgacgagaagcag
tgcggccatcaggacggcaaggtcaccgtgccgcacgaggacttcctccagaagatccgc
gcgatccgctatgccttcctcgaactgggcgtggaggacggcatcatcgtcgcgcgcacg
gattcgctcggcgcgggcctcaccaagcagatcgcctacagccgcgagcccggcgatctg
ggcgaccagtataatggcttcctcgattgcgaggacatcgaccccgccgatgtcggcaat
ggagaggtgttcatcagccgcgcaggcaagctgctgcgcccgaagcgcctgccctcgaac
ctctaccagttccgccccggcacgggagaggaccgctgcgtgctggacagcatcacggcg
ctgcgcaacggcgcggacctgctgtggatcgaaaccgagaagccgcatatcgggcagatc
gccggcatgatggatcgcatccgcgcggtgatccccaacgcgaagctggtctacaacaat
tcaccgagcttcaactggacgctcaatttccgccagcaggtgttcgatgcctgggaagcg
gaaggccgcgacgtctccgcctatgaccgcgccaagctgatgagcgcggactatgacggc
acggcgctggccagcgaagcggacgagcgcatccgcacgttccagcgcgatgcctcggcc
cgcgctggcatcttccatcacctcatcaccctgccgacctatcacacggcggcgctgagc
acggacaatctggcgcgcgactatttcggcgaacagggcatgctcggctatgtcgcgggc
gtgcagcgccgggagatccgcgaaggcatcgcctgcgtgaagcaccaggccatggcggga
tccgacatcggcgacgatcacaaggattatttcgccggggacgccgcgctcaaggccggt
ggcggcgccaacaccatgaaccagttcgccgcctga

DBGET integrated database retrieval system