KEGG   Sphingobium sp. SYK-6: SLG_10340Help
Entry
SLG_10340         CDS       T01622                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SLG_10340 (malQ)
Enzymes [BR:ssy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SLG_10340 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1095070..1097043)
Genome map
AA seq 657 aa AA seqDB search
MRAEPDLDRLAAALGLSRQWTDAEGRPAEVAPDDLVAVLGALGYPAGTSADRAQSLARCE
AEQRQPPRFLSGDAGQPIPLPAGLARHERAELILEDGEPLALSIRGGSLPPIARTGYHRL
YVDGHEMVLAIAPARCRLPDRGWGSSVQIPALRGPGAFGTLDDLAEAAHLFGARGAAFLA
ISPVHALIPGRTEHYSPYAPSSRRFLNSALAPLGLQETVNASALIDWSAALPAALDALER
SYAGLTAPQRRDLHDWAAGEGEALYRHAAFDALHLSPPLRARWSDDLRTAAEDPLRAFIA
THPDALGVHLLGQRLAAQALARAQASARASGMGIGLIADLAVGVDPRGSDVWASPSAYLR
KLTIGAPPDPLGPTGQNWGLTTFSPRALADQAFEPWIAMIRAALHHCGGVRIDHAFGLQR
LWVIAEGSPSSAGAYLACPFEDMLRIIALESQRHDAIIVAEDLGTIPAGFRERANDRGML
GMRVLPFEREGDGRFLPPDAYEAQSVAMTGTHDTATLAGWWSGHDLEWTARLHQAFDLAA
AQAIRARDRTLLWQAIGTGPLPPPTDSSQVVDAAVDHISRTRSVLAMVSLEDLIGAEDQV
NIPGTTHEHPNWQRRLPAPLAQLLHRPDVTRRLHALDARSGRREGTGKGVDPPPNVT
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgaacccgatctggacaggctcgcggccgctctgggcctatcaaggcaatgg
accgacgccgaggggcgcccggccgaggtcgcccctgacgacctcgtcgccgtgctcggc
gcgctcggttatcccgccgggacgtccgcagaccgggcgcagagcctcgccagatgcgag
gcggagcaacgccagcccccgcgcttcctcagcggcgatgccggacaacccattcccctt
ccggcagggctcgcccggcacgaacgggccgagctgatcctggaggatggagagccgctc
gcgctgtccattcgcgggggcagcctgccgcccatcgcacggaccggctatcaccggttg
tacgtcgacggccatgaaatggtcctcgccatcgcgccggcgcggtgccgccttcccgat
cggggctggggctcgtccgtgcagataccggccctgcggggaccgggcgcgttcggcacg
ctggatgatctggcggaagcggcgcacctcttcggagcgcgcggcgccgccttcctcgcg
atcagtccggtccacgccctcattcccgggcgcacggagcattacagcccctatgcgccg
tccagccgccgctttctcaatagcgcgctggcgccactcggcctgcaggagaccgtcaac
gcctcggcactgatcgactggtccgccgctctccccgccgcgctcgatgcgctggagcgc
agctatgccggtctgacggcgccgcagcgacgagacctgcatgactgggcggcgggggaa
ggcgaagcgctgtaccggcacgccgcgttcgatgccctgcatctctcgcccccgctccgc
gcgcgctggtcggatgatctgcggacggcggccgaggacccgctccgcgcgttcatcgcc
acgcatcccgacgcgcttggcgtccatcttctcggccagcgcctcgccgcgcaggcgctg
gcccgcgcacaggcctcggcccgcgcgtccggcatgggcatcggcctgatcgcggatctg
gccgtcggcgtcgatccccggggcagcgatgtctgggccagcccctccgcctatctccgg
aagctcacgatcggcgcgccgcccgatccgctgggaccgacgggacagaattggggcctc
acaaccttctcgccgcgcgccctggcggatcaggcattcgagccctggatcgccatgatc
cgcgcggccctgcaccattgcggcggcgtgcgcatagaccatgccttcgggctgcagcgc
ctgtgggtcatcgccgagggcagccccagcagcgccggcgcttatctggcctgccccttc
gaggacatgctgcgcatcatcgccctggagagccagcggcacgatgcgatcatcgtcgcc
gaggatctgggcaccatacccgccggcttccgcgagcgggcgaatgaccgcggcatgctc
ggcatgcgcgtcctccccttcgagcgggagggcgatggccgcttcctgccccccgacgca
tacgaggcccagagcgtcgccatgaccggaacgcacgatacggccaccctcgccggctgg
tggagcggccatgatctcgaatggaccgcgcgcctgcaccaggcgttcgacctggccgca
gcgcaggcgatccgggctcgcgaccggaccttgctctggcaggcgatcggcaccgggccc
ctccccccgcccacggactcctcacaggtcgtcgacgccgcggtggaccatatctcccgc
acgcgctcggtgcttgccatggtttcgctggaagacctgatcggcgccgaggatcaggtg
aacatcccgggcaccacccacgaacacccgaactggcaacgccgcctgcccgcgccgctc
gcacagctcctccaccgcccggacgtcacacgccgcctccacgcgctcgacgcgcgatcg
gggcggcgcgaggggactggcaagggggtggatccgccccccaatgttacttaa

DBGET integrated database retrieval system