KEGG   Sphingobium sp. SYK-6: SLG_10820Help
Entry
SLG_10820         CDS       T01622                                 

Definition
cobaltochelatase
Orthology
K02230  
cobaltochelatase CobN [EC:6.6.1.2]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SLG_10820
Enzymes [BR:ssy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.2  cobaltochelatase
     SLG_10820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1143137..1146919
Genome map
AA seq 1260 aa AA seqDB search
MSWLPLVARLLLALCMIGIGAAGHVQPAPPRPDLPRPDLPRIAFVSIHIAEMPTIAKAGA
RRVADDVTVDFFGLGGGLVPSIEGVDLGRYDLVLLDAAGPRLLNFTRQIEDAKMRTKVLV
VGPGTPIAGTIDPAAHPDIARYWTNATEANFAGLFAYAAARVLGRSMAVPPPVDFPPLAL
WHPDAPAPFAAMADYLGWASARFADAGARPKVGILFYRSLVLANNAGLVTALVREIERQG
GMPVPIWREGGGDLASTLLGDTRLDALILCGNRIDYASAQAGVAEAERLGVPPLMCATDY
RGDADAWRSSLGGFAPASTGELAMSELDGIVEPMILAARATAPDGTASYDPIADQIRWRV
ARALAWANLRRLPNADKHVVVSYHNEEPGEADVGSDPDSYLDAQGSMVALLERLRAEGYD
TGAAPLPDRATLARRLATEATNAAQGDDEALRRRIAQGAIAVPVRTYLAWYAALPAALKQ
EVERVWGPPPGKLMTVDGQVVVPALQFGKVILAAHPLWGPQTGGKALEQRGALPPHHQYL
AFYLWMQKSGRADAYLPLFTQLSLMPGKQEGPAATDAVGLLIGALPHIQPQPLQANGGVG
NKRRTQAVTIGFMPQFVRAGLSPPLAEMKAMLDADPVDEAALRRAVAAAGLAASLGLDPA
SAPFDALRAGLATYLAEAEAAPIPLGGHILGQAPASDVAARMVQAMLAVGQPAPHLEDVA
RALGGEDDVLDAENTHRARDYAARIASAPREMDAIIAALAGGYVPPGPMQDAIRNPDALP
AGRNPYTLDVRAVPTPQAWDRGVTLADEMLADYRAKHGRLPRKVAFVLWSSETAQNGGTN
EAQILHLLGVRPIRDARGHVVDIALVDRAALGRARVDVLVTTSGTYRDHFGEKLALIARA
IRLAAQAEEADNPVRAETQARARALQAQGVVPETAEKRALRRIFSTAPGAYSPSTQFANR
EGWSKAKLDELYRARMGHAYGDGDDGEPDSTAFTASLGTVDAAVFSRSSSAYGLLDTPMP
AAYLGGLSMAVQQETGRTIEGYIANEQASGQPHVETVDRFYARERDSRYLNPAWIKAMQA
SGYNGARYMADLTDSMSLWEQTRPDLVSDRDWEAVRDVYLHDRYRLGMDRYFAEHNPAAR
QKLVRTMLDAIDRGDWKADDATRAELQRTSNVRPPTSGREIAPVTRSESPASRGPITAQN
QVPSAARAPQAPLVSGYELEPAKSNAPIQPPARRTMLATTITAVLVALLLIGGAALRPRW
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcttccactggtcgcgcgacttctgctggcgctgtgcatgatcggcatcggc
gcggcgggccatgtccagccagccccgccacgcccggacttgccacgtccggacctgcca
cgcatcgccttcgtgtccatccacatcgccgaaatgccgacgatcgcgaaggccggcgcg
cggcgcgtggcagatgatgtcacggtggacttcttcggcctgggcggagggctggtgccc
tcgatcgagggggtcgaccttggccgctatgatctggttctgctcgatgccgccggaccc
cgcctgctcaatttcacgcgccagatcgaggatgccaagatgcgcaccaaggttctggtc
gtgggccccggaacgccgatcgcgggtacgatcgaccctgctgcccatcccgatatcgcg
cgctactggaccaatgcgaccgaagcgaatttcgccgggctgttcgcttatgccgctgcg
cgggtgctggggcggagcatggccgttccgccacccgtcgattttccaccactcgcgctt
tggcatcccgatgcgccggcgccctttgccgccatggccgactatctgggctgggcctct
gcgcgctttgccgatgcaggcgcacggccgaaagtgggcatcctgttctatcgcagcctc
gtgctggcgaacaacgccgggctggttacggcactcgtccgggaaatcgaacggcaaggg
ggcatgccggttcccatctggcgggagggtggcggcgaccttgcctccaccctgctcggc
gacacgcggctcgatgccctgatcctgtgcggcaaccggatcgactatgcatcggcacag
gccggggtggctgaggcagagcggctgggcgtgcctcctttgatgtgcgcaaccgattat
cgcggcgatgcggatgcctggagaagcagcctgggtggcttcgcgccggcttcgaccggc
gagctggcgatgagcgaactcgatggcatcgtcgagccgatgatcctggccgcccgcgcc
accgcgccggacggcacggcgagctatgatcccattgccgaccagatccgctggcgcgtc
gcgcgggccctcgcctgggcgaacctgcgccgcctgcccaacgcggacaagcatgtcgtc
gtcagctatcataatgaggagccgggcgaggccgacgtcggcagcgatccggattcctat
ctggatgcgcagggcagcatggtcgcgctgctcgagcggcttcgcgcggaggggtatgat
acgggcgccgcgcccctgcctgacagggcgacgctcgctcgccgtctcgccacggaagcg
accaatgccgcccagggcgatgacgaggccctgcggcgcaggatcgcacagggagccatc
gcagtcccggtccggacatatctcgcgtggtatgcggctctccccgccgcgctgaagcag
gaggtcgagcgggtctggggtccaccgccgggcaagctcatgacggtggacgggcaggtc
gtcgtcccggccctgcagttcggcaaggtcatcctcgctgcccatccgctctgggggccc
cagacgggcggaaaggcactggaacagcgcggcgcgctcccgccccatcaccagtatctg
gccttctacctgtggatgcagaaaagcgggcgggcggacgcctatctgccgctcttcact
cagttgtcgctgatgcctggcaagcaggaggggccggccgccacggatgcggtgggtttg
ctgatcggggcgctcccccacatccagccccagccgttgcaggccaatggcggcgtgggc
aacaagcgccgcacgcaggccgtgacgatcggcttcatgccgcaattcgtccgtgcaggc
ctgtcgccgccgctcgccgaaatgaaggccatgctggacgccgatccggtggacgaggca
gcgctgcggcgcgcggtcgccgcggcgggtcttgccgcctcgctcggcctcgatccggcc
agcgcaccatttgacgcgctgcgtgcggggctggccacttaccttgccgaggcggaagca
gcgcccattccgctgggcggccacatattgggacaggcgcccgcgagcgatgttgccgcg
aggatggtgcaggccatgctggcggtcgggcagcctgcgcctcatctggaggatgtggcg
cgcgcccttggcggcgaggacgatgtgctggacgcggaaaacacccaccgcgcccgggat
tatgcggcacgaatcgccagtgcaccgcgcgagatggatgcgatcattgcggcactggct
ggcggttatgtgccccccggcccgatgcaggacgcgatccgcaatcccgacgccctgccg
gccggccgcaatccctatacgctggatgtgcgcgcggtgccgacgccgcaggcctgggac
cggggcgtaacgctggccgatgagatgcttgccgactatcgtgcgaagcatggccgcttg
ccgcgcaaggtcgccttcgtgctgtggtccagcgagaccgctcagaacgggggaaccaac
gaagcccagatcctgcatttgctcggcgtgcgcccgatccgcgatgcgcgcggccatgtg
gtggacatcgcccttgtcgatcgcgccgcactgggccgggcgcgggtcgacgtgctggtg
acgacatcgggcacgtatcgcgatcatttcggcgagaagcttgccctgatcgccagggcg
atccgcctcgccgcgcaggctgaggaggcggacaatcccgtgcgcgccgaaacgcaggcc
cgcgcccgcgccctgcaagcgcagggtgtcgtacccgaaacggcggaaaagcgggccctg
cgccgtatcttctccaccgcgcccggcgcctattcgccctccacccagttcgccaaccgc
gagggatggagcaaggcgaagctcgatgagctctatcgtgcccggatgggccatgcctat
ggcgacggtgacgatggcgagccggacagcacggctttcaccgcgagtctcggcacggtc
gacgcagcggttttcagccggtcttccagcgcttatggcctgctcgatacgcccatgcct
gccgcttatctgggcggtctctcgatggccgtgcagcaggaaaccggccgcaccatcgag
ggctacatcgccaacgagcaggcctcgggccagccgcatgtcgaaaccgtcgaccgcttc
tatgcgcgcgagcgcgacagccgctatctcaaccccgcctggatcaaggccatgcaggcg
agcggctacaatggcgcgcgctacatggcggatctcaccgactccatgtcactctgggag
cagacccgcccggacctggtgtcggaccgggactgggaggccgtgcgcgacgtgtatctg
cacgatcgctaccggctgggcatggaccgctacttcgccgagcataacccggcggcgcgc
cagaagctggtccgcaccatgctggatgcgatcgaccggggcgactggaaggccgatgat
gccacgcgcgccgaactccagcggacgagcaacgtgcgaccgccgaccagtggccgggag
attgcgccagtaaccagaagcgaaagtcctgcatcccgggggccaataaccgcgcaaaac
caggtgccgtcagcagcccgcgctccacaagctcctcttgtgtcgggatacgagcttgag
cccgccaaatccaacgcgccgatccaacctccggcgcgccggacaatgctggcgacgaca
atcaccgcggtcctcgtcgctttgctgctcatcggcggcgcggcgctcaggccccgttgg
tag

DBGET integrated database retrieval system