KEGG   Sphingobium sp. SYK-6: SLG_11940Help
Entry
SLG_11940         CDS       T01622                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLG_11940 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLG_11940 (sdhD)
   00650 Butanoate metabolism
    SLG_11940 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SLG_11940 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1291837..1292226
Genome map
AA seq 129 aa AA seqDB search
MGTGTGVGRVRGLGSARSGTHHWVAQRVTAVGNALLVTWFVVSLAMLPSYDHAAVTGWLA
QPIVALPMMLMIANLFYHIRLGLQVLIEDYVHDEGLKFATLILLHFFVIGCAAVGLFSVA
RIAFAGGAF
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgggaacgggagtaggccgcgtccgcggtctcggatcggcgcgcagcggcacg
catcattgggtcgcgcagcgcgtgacggcggtgggcaatgccctgctggtcacctggttc
gtcgtcagcctcgcgatgctgccatcctatgatcatgccgcggtcaccggctggctcgcc
cagcccatcgtcgcgctgccgatgatgctgatgatcgccaatctcttttaccatatccgg
ctggggctgcaggtgctgatcgaggactatgtccatgacgagggcctgaagttcgccacg
ctcatcctgctccatttcttcgtgatcggctgcgcggccgtcggtctcttctcggttgcc
cgaatcgcatttgccggaggcgcgttctga

DBGET integrated database retrieval system