KEGG   Sphingobium sp. SYK-6: SLG_13960Help
Entry
SLG_13960         CDS       T01622                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ssy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ssy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1514717..1515799)
Genome map
AA seq 360 aa AA seqDB search
MTKLLIVDDSPLMRKLLTEIFTEAGGFDLAVARDGGEALEQVHAFAPDVVTLDIHMPSLD
GLACLDRIMVERPTPVVMVSSLTEEGAEETLEALSLGAVDFVAKPRGPLSLEIDNVAGLL
VQKVRTAAGARLSRAARLTDRVRLRTARPPRPARPAKPAPRPKPGDRLAGIAAVLVGVST
GGPPALDMLLQPIPADFPWPIVIAQHMPRSFTGPLARRLDGCCAISVVEVTRPMPLQPGH
AYIGRGDADLLISRRSGGVVAMPAPARPDLHWHPNADRLVESAIAALGAQALVGVLMTGM
GSDGAKAMAALRQGGGHVIAQDAGTSVVWGMPGTLVALDGADLVLPLPEIAPQLIDWAVG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaactcctcatcgttgacgattccccgctgatgcggaagctcctgacggagatc
ttcaccgaggccggcggctttgatctcgcggtcgcccgcgatggcggcgaggcgctcgaa
caagtgcatgccttcgcgcccgacgtggtgacgctggacattcacatgcccagcctcgac
ggtcttgcctgccttgaccggatcatggtcgagcggcccacccccgtggtcatggtctcc
tcgctgaccgaggaaggcgccgaggaaacgctcgaagcgctctcgctcggcgcggtcgat
ttcgtcgccaagccgcgcgggccgctctcgctcgagatcgacaatgtcgcgggcctgctg
gtgcagaaggtccggaccgcagcaggggcgcgtctctcgcgcgccgcccggctcaccgac
cgggtgcggctgcgcacggcaaggccgccgcgacccgcccggccagcgaagcccgccccc
agacccaagcccggcgacaggctcgcaggcatcgcggccgtgctggtcggcgtctcgacg
ggcggtcctcccgctctcgacatgctgctccaacccattccggcggacttcccctggccc
atcgtcatcgcgcagcacatgccccggagcttcacgggccctctcgcgcgccgcctcgat
gggtgctgcgcgatcagcgttgtcgaggtgacgcggccgatgccgctccagccgggccac
gcctatatcggccggggcgatgcggacctgctgatttcgcggcgttccggcggggtcgtc
gccatgcccgcgcctgcccgccccgatctgcactggcatccgaatgcggaccgtctggtc
gagagcgccatcgcggcgctgggtgcgcaggctctggtgggcgtgctgatgaccggcatg
ggctcggacggcgcgaaagccatggcggcgctgcgccagggtggcggccatgtcatcgcg
caggatgccgggacatcggtggtgtggggcatgcccggtacgctggtcgcgcttgacggc
gccgatctcgttctgcccttgccggagatcgcgccgcagctcatcgattgggccgtcgga
tga

DBGET integrated database retrieval system