KEGG   Sphingobium sp. SYK-6: SLG_14930Help
Entry
SLG_14930         CDS       T01622                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SLG_14930
   00240 Pyrimidine metabolism
    SLG_14930
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SLG_14930
   03430 Mismatch repair
    SLG_14930
   03440 Homologous recombination
    SLG_14930
Enzymes [BR:ssy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SLG_14930
DNA replication proteins [BR:ssy03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SLG_14930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1629737..1630174
Genome map
AA seq 145 aa AA seqDB search
MQVDFYQLSRDPVETVMPAIARRILESGGRLLVVSDERDQLDRISRGLWNAGPETYLAND
HADAPASHVQPVLLSPGCEPLNGARHAALADGRWREEVLGFDRAFYFFDEATIAGARAAW
RALSRTDGVVPRFWKQEGGRWRQGP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcgacttctaccagctcagccgcgatccggtcgaaaccgtcatgcccgcgatc
gcgcgcaggatcctggagagcggtggccggctgctggtggtctcggacgagcgggaccag
ctcgaccggatttcccggggcctgtggaacgcggggccggagacctatctcgcgaacgat
catgccgacgcgccggcgtcgcatgtccagccggtgctgctctcgcccggttgcgagccg
ctgaacggcgcccgtcatgcggcgctggcggatggtcggtggcgggaagaggtccttggc
ttcgatcgggctttctacttcttcgacgaggcgaccatcgccggtgcgcgtgcggcatgg
cgcgcgctgagccggacggacggcgtcgtccctcgtttctggaagcaggaaggcggccgc
tggcggcagggaccctga

DBGET integrated database retrieval system