KEGG   Sphingobium sp. SYK-6: SLG_15490Help
Entry
SLG_15490         CDS       T01622                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SLG_15490 (dxr)
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SLG_15490 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1691266..1692432
Genome map
AA seq 388 aa AA seqDB search
MSAVRSISVLGATGSVGQSTLDLIGREADRYEVLALTAGSDVAGLAATAIRHRARYAVIA
DADRYADLRSALAGTGVEAAAGPTALIEAGALGADWTMAAIVGCAGLAPTLAAIREGRTV
ALANKEALVSAGDVMMAATQESGANLLPVDSEHNAIFQCLASGGIDAVRRITLTASGGPF
RTLSRDEMARVTPAQAVKHPNWSMGRKISVDSATMMNKGLELIEAWHLFPVGLERFSVLI
HPQSIIHSMVEFRDRSTIAQLGCPDMRVPIASTLAWPARMETPCEPLDLARIGRLDFEEP
DEVRFPALRLAREAIEARGSAPGILNAANEVAVAAFLEGRIRFLDIGRIVEDVLARTDIM
PVRGIEDVWAIDRSARHLAERLAAELIT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgtccgcagcatttccgttctcggtgccaccgggtccgtcgggcaatcgacg
ctggatctcatcggccgtgaggcggatcgatacgaggtcctagcattgactgccggcagc
gatgttgctggactcgcggccacggcgatcaggcatcgggcgcgctatgcagtgattgca
gatgctgatcgctatgcggatctgcggtcggctctggccggcaccggcgtggaagcagca
gccggccctacagccctgatcgaggccggggcgcttggcgccgactggacaatggccgcg
attgtcggctgcgccggactcgcgccaaccctggccgcgatccgcgaagggcgcactgta
gcgcttgccaacaaagaggcgctggtctccgcaggtgacgtcatgatggcggcgacgcag
gaaagcggagccaacctgctgcccgtggacagcgagcataacgcgatttttcagtgcctc
gcgagtggcgggatcgatgctgtgcgcaggatcaccctcaccgcgagcggaggtccgttc
aggacgctgtcacgcgatgagatggcgcgggtgacgccggcgcaagccgtgaagcatcca
aactggtcgatggggcgcaagatcagcgtcgacagcgccacgatgatgaacaaggggctg
gagctcatcgaagcctggcacttgttccccgtgggactggagcggttctccgttcttatt
catccgcaatcgatcattcattccatggtggaattccgcgatcgctcgaccatcgctcag
ctgggctgtccggacatgcgcgtgcctattgccagcacgctggcctggccggccagaatg
gaaacgccctgcgagccgcttgatctcgcccgcattggccgactggatttcgaggagcct
gatgaggtgcgctttcccgcgctgcggctcgcccgcgaggccattgaagcgcgtgggagc
gcgcccggaatcctgaatgcggccaacgaagtggcggtcgcggctttccttgaggggcgg
attcgttttctggacattggccggatcgtggaagacgtgctagcgcggaccgacatcatg
ccggtccgaggcatcgaggacgtctgggcgatcgacaggtcggcacggcatctcgccgag
cgcctggcagcggagctcatcacgtga

DBGET integrated database retrieval system