KEGG   Sphingobium sp. SYK-6: SLG_15980Help
Entry
SLG_15980         CDS       T01622                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00071  Fatty acid degradation
ssy00280  Valine, leucine and isoleucine degradation
ssy00281  Geraniol degradation
ssy00310  Lysine degradation
ssy00360  Phenylalanine metabolism
ssy00362  Benzoate degradation
ssy00380  Tryptophan metabolism
ssy00410  beta-Alanine metabolism
ssy00627  Aminobenzoate degradation
ssy00640  Propanoate metabolism
ssy00650  Butanoate metabolism
ssy00903  Limonene and pinene degradation
ssy00930  Caprolactam degradation
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SLG_15980
   00650 Butanoate metabolism
    SLG_15980
  Lipid metabolism
   00071 Fatty acid degradation
    SLG_15980
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLG_15980
   00310 Lysine degradation
    SLG_15980
   00360 Phenylalanine metabolism
    SLG_15980
   00380 Tryptophan metabolism
    SLG_15980
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLG_15980
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SLG_15980
   00281 Geraniol degradation
    SLG_15980
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLG_15980
   00627 Aminobenzoate degradation
    SLG_15980
   00930 Caprolactam degradation
    SLG_15980
Enzymes [BR:ssy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SLG_15980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAK66273
NITE: SLG_15980
UniProt: G2ISB3
Position
complement(1750284..1751060)
Genome map
AA seq 258 aa AA seqDB search
MSYETILVERHDAVTLVTLNRPQALNALNSQVLADLIDVMAAYDADPGQRCLVVTGSEKA
FAAGADIKEMADKSGADMFAAELYAEWNTRVCATRKPWIAAVAGFALGGGCELAMMADFI
IAADTAKFGQPEITLGVAPGMGGSQRLTRALGKAKAMEMCLTGRRMDAAEAERAGLVARV
VPAADLLDEALSTAKAIAAMPPLAAIANKELVNVAFETSLSQGLVNERRLFQLLASTQDK
AEGMSAFIEKRPPTWTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgaaacgatccttgtggaacgacacgacgctgtcacgctggtcacgctcaat
cgtccgcaagccctcaatgccctgaacagccaggtcctcgccgatctgatcgatgtcatg
gcggcttatgatgccgatcccggccagcgctgcctggtcgtcacgggcagcgagaaggca
tttgcggccggtgcggacatcaaggagatggccgacaagtccggcgcagacatgtttgct
gcggaactctatgcggaatggaacacgcgcgtttgcgcgacgcgcaagccctggatcgcc
gccgtcgccggcttcgcgctcggcggcgggtgcgagctcgcgatgatggcggacttcatc
atcgctgccgacaccgcgaagttcggccagccggaaatcacgctcggcgtcgcgccgggc
atgggcggatcgcagcgcctcacgcgcgcgctgggcaaggccaaggcgatggaaatgtgc
ctgaccggccgccgcatggacgcggctgaggccgaacgcgccggcctcgtcgcccgcgtg
gtgccggcggccgatctgctcgacgaagcgctgtcgacggcgaaagccatcgccgccatg
ccgccactcgcggcgatcgcgaacaaggaactggtcaatgtcgccttcgaaacctcgctt
tcgcaagggcttgtgaacgagcggcgcctgttccagttgctcgcctcgacgcaggacaag
gccgagggcatgtccgccttcatcgagaaacggccgccgacctggacggggcgctga

DBGET integrated database retrieval system