KEGG   Sphingobium sp. SYK-6: SLG_19770Help
Entry
SLG_19770         CDS       T01622                                 

Definition
putative protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ssy  Sphingobium sp. SYK-6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2169216..2170007
Genome map
AA seq 263 aa AA seqDB search
MSGICGAALLALLQPGAAFAKEDQGRTSDTALAKAVDEAERQLQQTFTNLRFEDFGPSPV
EGPIYQASAGGRIVYYAPQSEHILFATVYDRNGVNLTALAQEQGATRRLKAIDPAKALAI
GPAGAPTVIEFTDPDCPYCQALDRFWAAKAAEGKPVRRLIFFVSGIHPTAAAKGEHILCS
PDREAAFKAAYSGQSPAALAQCAQGRAKVADDAELVARIGISGTPTLIADGKLISGFQQA
ELEAFLDSHAKPSAAKAASDASR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggtatttgcggggcggcattgctggccctcctgcagcctggcgcggcgttcgcg
aaagaggatcagggccgcacatcggataccgcgcttgccaaggctgtggacgaagcggaa
cggcaactccagcagaccttcaccaacctccgcttcgaggattttggcccctcgcccgtt
gagggtccgatctatcaggccagcgccggcggccggatcgtctattacgcgccgcaaagc
gagcatatcctgttcgctacggtctatgatcgtaacggcgtcaatctgaccgcgctggcg
caggaacagggcgcgacgcgccgcctgaaggccatcgatcctgccaaggcgctggcgatc
ggtcctgccggcgcgcctacggtcatcgagttcaccgatcccgactgtccctactgccag
gcgcttgatcgcttctgggccgcgaaggcagcggagggcaagcctgtgcggcggctcatc
ttcttcgtgagcgggatccacccgaccgccgcggcaaaaggggaacatatactgtgctcg
cccgatcgcgaggctgcgttcaaggcggcctattccggccaaagtccggccgcgctggcg
caatgcgcgcaggggcgcgccaaggttgccgacgatgccgagctggtcgccaggatcggc
atttcgggaacgccgaccctgatcgccgacggcaagctcatttccgggttccagcaggcc
gagctcgaggcttttctcgacagccacgcgaagccctcggcggcaaaggcggcgagcgat
gcgtcccgctga

DBGET integrated database retrieval system