KEGG   Sphingobium sp. SYK-6: SLG_20410Help
Entry
SLG_20410         CDS       T01622                                 

Definition
putative 6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLG_20410
   01230 Biosynthesis of amino acids
    SLG_20410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_20410
   00030 Pentose phosphate pathway
    SLG_20410
   00051 Fructose and mannose metabolism
    SLG_20410
   00052 Galactose metabolism
    SLG_20410
  Energy metabolism
   00680 Methane metabolism
    SLG_20410
Enzymes [BR:ssy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SLG_20410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2239066..2240016)
Genome map
AA seq 316 aa AA seqDB search
MDRIATFTMNPTIDAAYETDRVFHTHKMRTQGEHYDPGGGGINISRVIARLGGTARAYYA
SGGATGVALDGLLDLHQMVRHRIPIAGSTRISASLYDRESGKEYRVVPAGPSFTEEECER
CLAEIAQAGCDYFVASGSLAPGVPEDFYARALAACRQRGIRFVLDTSGAALKATLDAGGV
FLVKPSLGELQALVGKPLEGLREIADAARAFVQSGQTHYMAVTMGHEGALLAHGDEVVCL
PTIAVQAMSAVGAGDSFLAAMVFALANGRDVTEAFRYGIAAGAAAVLTPGTDLCRREDVE
RLYREVAPLSAARVIG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggacaggatagccaccttcacgatgaacccgaccatcgacgcggcctatgagacggac
cgcgtctttcacacgcacaagatgcgcacgcagggcgagcattatgatcccggcggtggc
ggcatcaacatatcgcgcgtgatcgctcgcctcggcggaacggcgcgggcttattatgcc
tcgggcggggcgacgggcgtggcgctcgacggcctgctcgatctccaccagatggttcgc
caccggatcccgatcgcaggcagcacccggatcagcgcctctctctatgatcgggagagc
ggcaaggaatatcgggtcgtgccggcggggccgtcgttcacggaagaggagtgcgagcgc
tgcctggccgagatcgcgcaggccgggtgcgactatttcgttgcgagcggctcgcttgcc
cccggggtgcccgaggatttctatgcgcgggcgcttgccgcgtgccggcagcgcggcatc
cggttcgtgctggatacctcgggcgccgcattgaaggcgacgctggacgcgggcggcgtc
tttctcgtgaagcccagcctcggtgagttgcaggcgctggtcggcaagccgctggagggt
ctgcgggagatcgccgacgcggcgcgggctttcgtgcagagcggccagacgcactacatg
gccgtcaccatgggccatgaaggcgccttgcttgcccatggagatgaggtcgtctgcctt
ccgaccattgccgtgcaggcgatgagcgcggtcggggcgggggacagttttctcgccgcc
atggtcttcgccctggccaacggccgggatgtgaccgaggcgttccgctatggcatcgct
gccggcgcggctgctgtgttgaccccgggcacggacctgtgtcgcagggaagacgtggag
cgcctgtatcgggaagttgcgccgttgagcgcggcgcgcgtcatcgggtga

DBGET integrated database retrieval system