KEGG   Sphingobium sp. SYK-6: SLG_20620Help
Entry
SLG_20620         CDS       T01622                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ssy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ssy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2264071..2265057
Genome map
AA seq 328 aa AA seqDB search
MTVSPSPSTGLVGRASFPHRHLLGIASLAPHEIRFLLDEAEHWAALNRADTRKLDGRLAG
LTQMNAFFEASTRTLLSFEVAGKRLGADVVNMHAAQSSVKKGETLIDTAVTLNSMRAGVM
VIRHMSSGAVQLIADKVDCPVLNAGDGRHEHPTQALLDALTIRRHKGSFEGLIVTICGDI
LHSRVARSNMLCLTALGAQVRICAPPTLMPPGIERYRVTPFTDFDAALEGADVAMALRVQ
NERMDGGFIPSSREFHMLYGLTPERLKRAKPDVLVMHPGPMNRGVEITSGVADGAHSAIT
EQVEMGVAVRMACLDVLTRSARGVAGWA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgtcaccctccccctccaccggccttgtcgggcgggccagtttcccgcaccgg
catctcctgggaatcgccagcctggcgccccatgaaatccgcttcctgcttgacgaagcc
gagcattgggcagcgctcaatcgggcggatacgcgcaagcttgatggccggcttgccgga
ctcacgcagatgaacgccttcttcgaggccagcacgcgcacgctgctttccttcgaggtg
gcgggcaagcggctcggtgccgacgtggtgaacatgcatgccgcccagtccagcgtgaag
aagggcgaaacgctgatcgacaccgccgtgacgctgaactccatgcgcgccggcgtcatg
gtgatccgccacatgagttctggcgccgtgcaactcattgcggacaaggtggactgcccg
gtgctcaatgccggagacggacggcacgagcacccgacgcaggccctgctcgacgcgctg
accatccgtcggcacaagggcagcttcgagggactgatcgtcaccatctgcggcgacatc
ctgcacagccgggtcgcacgctcgaacatgctctgcctgaccgcgctgggcgcgcaggtg
cgcatctgcgcgccgcccacgctgatgccgccggggatcgagcgctaccgggtgacgccg
ttcaccgatttcgacgccgcccttgaaggcgcggacgtggccatggccctgcgcgtccag
aacgagcggatggatggcggcttcattccctcgtcccgcgagttccatatgctttacggc
ctcacgcccgagcgactgaaacgcgccaagcccgatgtgctcgtcatgcatccggggccc
atgaaccgcggcgtggagatcaccagcggggtcgcggacggcgcgcattccgccatcacc
gagcaggtggaaatgggcgtggccgtgcgcatggcctgtctcgacgtcctgacacgcagc
gcgaggggagtagcgggatgggcctga

DBGET integrated database retrieval system