KEGG   Sphingobium sp. SYK-6: SLG_20910Help
Entry
SLG_20910         CDS       T01622                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2296350..2297588)
Genome map
AA seq 412 aa AA seqDB search
MALLDELEGAMSGQRSDVPSGDRFRYENGMTLPADLPPPDATLYLRPIWFADTPVGLAES
DVRRLAGGLIWFQAVEVRWIDGTGASSKAQVPLGLLDRWQAGLSDRQAERIDGLMASLTA
QRAPLTLGERIVRFDTPQVMGILNMTPDSFSDGGKHVDAPERAADAGFAMQLAGASIIDV
GGESTRPGAAPVWEGDEIERTVPVIQRLARSGIMVSIDTRKASVMEAALAAGAGIVNDVT
GLTHDPRALEVVAAAGCPVILMHTPSAGEDPHGGAVRYKAGAVVEGAADLAVFDWLEARI
AVCLAAGVQRERIIVDPGIGFGKALQDDTRIINNLSMYHGLGVPILFGASRKRIVGALTD
GAPVDQRLGGSVALALTAIRAGAQIVRVHDVQESVQAARVWRGLRDAALVAG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctggatgaactggaaggcgcgatgtcggggcagcgaagcgatgttccctca
ggggatcgcttccgttacgagaacggcatgaccttgccagcagatttgccgccgcccgat
gcgacactctatctccgcccgatctggttcgccgacacccctgtggggctggcggaaagt
gatgttcggcgtctggccggcgggctcatctggttccaggcagtcgaggtccgctggatc
gacggcacgggcgccagcagcaaggcgcaagtgccgttgggtctgctcgaccgctggcag
gcagggctttccgaccggcaggccgagcgcatcgatggcctgatggcaagcctcacggcc
cagcgggcgcctctgactctgggcgagcggatcgtgcgcttcgacacgccgcaggtcatg
ggcatcctcaacatgacgccggacagtttctcggacgggggaaagcatgtcgacgcgccg
gagcgggcggccgatgccggcttcgcgatgcagcttgccggcgcctcgatcatagacgtg
ggcggggaatcgacgcggcccggcgctgcgccggtctgggaaggcgacgagatcgagcgg
acagttccggtcatacaaaggctggcaagaagcggcatcatggtttcgatcgacacgcgc
aaggccagcgtgatggaggctgcgctggccgccggggcgggaatcgtcaatgacgtgacg
ggcctgacgcatgacccccgcgcgctggaggtggtcgccgcagcgggttgcccggtgatc
ctcatgcacaccccttccgccggggaggacccgcatggcggcgctgtccgctacaaggcc
ggcgcggtggttgagggggcggccgatctggctgttttcgactggctggaagcgcggatc
gccgtctgccttgccgccggtgtgcagcgggagcggatcatcgtcgatccgggcatcggc
ttcggcaaggcactgcaggacgatacccggatcatcaataatctttcaatgtatcatggg
cttggggtgccgatcctgttcggcgcgagccgcaagcggatcgtcggcgcgctgacggat
ggcgcgccggtcgaccagcggctcggcggatcggtggcgcttgccctgaccgcgatccgc
gcgggcgctcagatcgtgcgcgtgcatgatgtacaggagagcgtgcaggcagctcgcgtc
tggcgtggcctgcgcgatgcggcgctggtggcgggatga

DBGET integrated database retrieval system