KEGG   Sphingobium sp. SYK-6: SLG_21380Help
Entry
SLG_21380         CDS       T01622                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00071  Fatty acid degradation
ssy00280  Valine, leucine and isoleucine degradation
ssy00281  Geraniol degradation
ssy00310  Lysine degradation
ssy00362  Benzoate degradation
ssy00380  Tryptophan metabolism
ssy00410  beta-Alanine metabolism
ssy00640  Propanoate metabolism
ssy00650  Butanoate metabolism
ssy00903  Limonene and pinene degradation
ssy00930  Caprolactam degradation
ssy01040  Biosynthesis of unsaturated fatty acids
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01200  Carbon metabolism
ssy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SLG_21380 (fadJ)
   00650 Butanoate metabolism
    SLG_21380 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SLG_21380 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SLG_21380 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLG_21380 (fadJ)
   00310 Lysine degradation
    SLG_21380 (fadJ)
   00380 Tryptophan metabolism
    SLG_21380 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLG_21380 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SLG_21380 (fadJ)
   00281 Geraniol degradation
    SLG_21380 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLG_21380 (fadJ)
   00930 Caprolactam degradation
    SLG_21380 (fadJ)
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SLG_21380 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SLG_21380 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SLG_21380 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored FAD_binding_3 Sacchrp_dh_NADP NAD_Gly3P_dh_N 2-Hacid_dh_C DAO Pyr_redox_2 UDPG_MGDP_dh_N XdhC_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: BAK66813
NITE: SLG_21380
UniProt: G2IHP0
Position
2338837..2341032
Genome map
AA seq 731 aa AA seqDB search
MATTLSLEVDGDGIALVTIDVPGQSMNVITPDFFDDLAGAITRIAEDEAVKGAVISSGKA
SGFMAGMDLKYLGKMLQDAQSDGGAGDDANMGQLFESVFRLNALLRRLETCGKPVAAAIE
GTCMGGGLELALACHRRVLTSDPRVTIGLPEILVGLFPGGGGSQRLPRLVGIQGALMYML
QGKSWRPAEALGMKVVDELAEPGKAIEAARAWVKANPGAHTQPWDVKGFKVPGGSGQFNP
GFIQTMMAATVMTTKTTQRNMNAPHALLSAVYEGIQLPMDKAIRVESKYFAKVVADPQAG
NMVRTLFVSKQAAERGARRPAGVEKAPTKKLAMLGAGMMGAGIANVAAQAGIEVVLLDRD
QAAADKGKAHAQAQMQKRLGRGMTPEKMEAALARITPVTDAAALKGCDFVIEAVFEDPAI
KAEITQRVEAVLGPDMIFGSNTSTLPITSLAKAWTKPENFIGVHFFSPVEKMPLVEIIMG
KQTGDAALAKALDFVAQIRKTPIVVNDSRGFYTSRCFGTYVQEGTQMLAEGINPALIENV
GRQLGMPVGPLAVSDEVSIELGHKVTVATKAALGDAYVPSLADDVAAHMVALGRLGRKNG
KGYYDYPADGGRKSLWPGLAAEYPLALMQPSPQAVRERLLYRQLVECARCFAEGVLVTPQ
DGDIGAIFGWGFAPYTGGPFSAIDTISPAKVVEVLDRLTAAHGERFAPPAQLREMATSGA
TYYGKAGARAA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggccactaccctctccctggaggtcgacggcgacggcatcgcgctggtcacgatcgac
gtgcccggccagtcgatgaatgtcatcacgccggatttcttcgacgatcttgccggcgcg
atcacgcgcatcgccgaggacgaggccgtcaagggcgccgtcatcagctccggaaaggcc
agcggcttcatggccggcatggacctcaaatatctcggcaagatgcttcaggatgcccaa
tcggacggcggcgcaggtgatgacgcgaacatgggccagctcttcgagagcgtgttccgc
ctcaatgcgctgctgcgtcggctggagacctgcggcaagccggtcgccgccgctatcgag
ggcacctgcatgggcggcggcctggaactggcgctggcttgccatcgccgggttctgacc
agcgatccacgcgtgacgatcggcctcccggaaatcctggtcggcctcttccccggcggc
ggcggctcgcagcgcctgccgcgtctcgtcggcatccagggcgccctcatgtacatgctg
cagggcaagagctggcgcccggccgaggcgctcggcatgaaagtggtcgacgagctggcc
gagcccggcaaggccatcgaggcggcccgggcatgggtgaaggccaatcctggcgcgcat
acccagccctgggacgtgaagggcttcaaggtcccgggcggatcgggccagttcaatccc
ggcttcatccagacgatgatggccgcgaccgtgatgaccaccaagaccacgcagcggaac
atgaacgcgccgcacgcgctgctctcggcggtctatgagggcatccagcttcccatggac
aaggcgatccgggtggaaagcaaatatttcgccaaggtggtggccgatccgcaggccggc
aacatggtgcgcacgctgttcgtctccaagcaggcggccgagcgcggcgctcgtcgcccg
gccggtgtcgagaaggcgccgacgaagaagctcgccatgctcggcgcgggcatgatgggc
gcgggcatcgcgaatgtcgccgcgcaggcggggatcgaggtcgtgctgctggaccgcgat
caggcggccgcggacaagggcaaggcccatgcgcaggcgcagatgcagaagcgtctcggc
cggggcatgacgcccgagaagatggaagcggcgctcgcccgcatcacgccggtcacggat
gccgcggcgctcaagggctgcgatttcgtcatcgaggcggtgttcgaggatccggcgatc
aaggcggagatcacgcagcgcgtggaagccgtgctgggcccggacatgatcttcggctcc
aatacttcaaccctgccgataacatcgctggccaaggcatggacaaaaccggagaatttc
atcggcgtccacttcttctccccggtcgagaagatgccgttggtggaaatcatcatgggc
aagcagaccggcgatgcggcgctcgccaaggcgctcgatttcgtcgcgcagatccgcaag
acgcccatcgtggtgaatgactcgcgcggcttctacacgtcccgctgcttcggcacttat
gtgcaggaaggcacgcagatgctggcggaagggatcaatcccgcgctgatcgagaatgtc
ggccggcagctcggcatgccggtggggccgctcgcggtctcggacgaagtgtccatcgag
ctgggccacaaggtgaccgtggcgacgaaggccgcgctgggcgatgcctatgtgccgagc
cttgccgacgatgtggccgcgcacatggtcgcgctggggcggctcggccgcaagaacggc
aagggctattatgactatccggccgatggcggccgcaagtcgctctggccgggccttgcc
gctgaatatcccctcgccctcatgcagccctctccacaggcggtgcgcgagcgcctgctc
tatcgccagctcgtcgagtgcgcgcgctgctttgccgagggcgtgctggtgacgccgcag
gatggcgacatcggcgccattttcggctggggcttcgcgccttataccggcgggccattc
agcgcgatcgacacgattagcccggcgaaggtcgtcgaggtgctggaccggctgacagcg
gcccatggcgagcgcttcgccccgccggcccagttgcgcgagatggcgacgagcggcgcc
acttattatggcaaggcgggcgctagggcggcttga

DBGET integrated database retrieval system