KEGG   Sphingobium sp. SYK-6: SLG_21380Help
Entry
SLG_21380         CDS       T01622                                 

Gene name
fadJ
Definition
fatty oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLG_21380 (fadJ)
   01212 Fatty acid metabolism
    SLG_21380 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SLG_21380 (fadJ)
   00650 Butanoate metabolism
    SLG_21380 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SLG_21380 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SLG_21380 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLG_21380 (fadJ)
   00310 Lysine degradation
    SLG_21380 (fadJ)
   00380 Tryptophan metabolism
    SLG_21380 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLG_21380 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SLG_21380 (fadJ)
   00281 Geraniol degradation
    SLG_21380 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SLG_21380 (fadJ)
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SLG_21380 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SLG_21380 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SLG_21380 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2338837..2341032
Genome map
AA seq 731 aa AA seqDB search
MATTLSLEVDGDGIALVTIDVPGQSMNVITPDFFDDLAGAITRIAEDEAVKGAVISSGKA
SGFMAGMDLKYLGKMLQDAQSDGGAGDDANMGQLFESVFRLNALLRRLETCGKPVAAAIE
GTCMGGGLELALACHRRVLTSDPRVTIGLPEILVGLFPGGGGSQRLPRLVGIQGALMYML
QGKSWRPAEALGMKVVDELAEPGKAIEAARAWVKANPGAHTQPWDVKGFKVPGGSGQFNP
GFIQTMMAATVMTTKTTQRNMNAPHALLSAVYEGIQLPMDKAIRVESKYFAKVVADPQAG
NMVRTLFVSKQAAERGARRPAGVEKAPTKKLAMLGAGMMGAGIANVAAQAGIEVVLLDRD
QAAADKGKAHAQAQMQKRLGRGMTPEKMEAALARITPVTDAAALKGCDFVIEAVFEDPAI
KAEITQRVEAVLGPDMIFGSNTSTLPITSLAKAWTKPENFIGVHFFSPVEKMPLVEIIMG
KQTGDAALAKALDFVAQIRKTPIVVNDSRGFYTSRCFGTYVQEGTQMLAEGINPALIENV
GRQLGMPVGPLAVSDEVSIELGHKVTVATKAALGDAYVPSLADDVAAHMVALGRLGRKNG
KGYYDYPADGGRKSLWPGLAAEYPLALMQPSPQAVRERLLYRQLVECARCFAEGVLVTPQ
DGDIGAIFGWGFAPYTGGPFSAIDTISPAKVVEVLDRLTAAHGERFAPPAQLREMATSGA
TYYGKAGARAA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggccactaccctctccctggaggtcgacggcgacggcatcgcgctggtcacgatcgac
gtgcccggccagtcgatgaatgtcatcacgccggatttcttcgacgatcttgccggcgcg
atcacgcgcatcgccgaggacgaggccgtcaagggcgccgtcatcagctccggaaaggcc
agcggcttcatggccggcatggacctcaaatatctcggcaagatgcttcaggatgcccaa
tcggacggcggcgcaggtgatgacgcgaacatgggccagctcttcgagagcgtgttccgc
ctcaatgcgctgctgcgtcggctggagacctgcggcaagccggtcgccgccgctatcgag
ggcacctgcatgggcggcggcctggaactggcgctggcttgccatcgccgggttctgacc
agcgatccacgcgtgacgatcggcctcccggaaatcctggtcggcctcttccccggcggc
ggcggctcgcagcgcctgccgcgtctcgtcggcatccagggcgccctcatgtacatgctg
cagggcaagagctggcgcccggccgaggcgctcggcatgaaagtggtcgacgagctggcc
gagcccggcaaggccatcgaggcggcccgggcatgggtgaaggccaatcctggcgcgcat
acccagccctgggacgtgaagggcttcaaggtcccgggcggatcgggccagttcaatccc
ggcttcatccagacgatgatggccgcgaccgtgatgaccaccaagaccacgcagcggaac
atgaacgcgccgcacgcgctgctctcggcggtctatgagggcatccagcttcccatggac
aaggcgatccgggtggaaagcaaatatttcgccaaggtggtggccgatccgcaggccggc
aacatggtgcgcacgctgttcgtctccaagcaggcggccgagcgcggcgctcgtcgcccg
gccggtgtcgagaaggcgccgacgaagaagctcgccatgctcggcgcgggcatgatgggc
gcgggcatcgcgaatgtcgccgcgcaggcggggatcgaggtcgtgctgctggaccgcgat
caggcggccgcggacaagggcaaggcccatgcgcaggcgcagatgcagaagcgtctcggc
cggggcatgacgcccgagaagatggaagcggcgctcgcccgcatcacgccggtcacggat
gccgcggcgctcaagggctgcgatttcgtcatcgaggcggtgttcgaggatccggcgatc
aaggcggagatcacgcagcgcgtggaagccgtgctgggcccggacatgatcttcggctcc
aatacttcaaccctgccgataacatcgctggccaaggcatggacaaaaccggagaatttc
atcggcgtccacttcttctccccggtcgagaagatgccgttggtggaaatcatcatgggc
aagcagaccggcgatgcggcgctcgccaaggcgctcgatttcgtcgcgcagatccgcaag
acgcccatcgtggtgaatgactcgcgcggcttctacacgtcccgctgcttcggcacttat
gtgcaggaaggcacgcagatgctggcggaagggatcaatcccgcgctgatcgagaatgtc
ggccggcagctcggcatgccggtggggccgctcgcggtctcggacgaagtgtccatcgag
ctgggccacaaggtgaccgtggcgacgaaggccgcgctgggcgatgcctatgtgccgagc
cttgccgacgatgtggccgcgcacatggtcgcgctggggcggctcggccgcaagaacggc
aagggctattatgactatccggccgatggcggccgcaagtcgctctggccgggccttgcc
gctgaatatcccctcgccctcatgcagccctctccacaggcggtgcgcgagcgcctgctc
tatcgccagctcgtcgagtgcgcgcgctgctttgccgagggcgtgctggtgacgccgcag
gatggcgacatcggcgccattttcggctggggcttcgcgccttataccggcgggccattc
agcgcgatcgacacgattagcccggcgaaggtcgtcgaggtgctggaccggctgacagcg
gcccatggcgagcgcttcgccccgccggcccagttgcgcgagatggcgacgagcggcgcc
acttattatggcaaggcgggcgctagggcggcttga

DBGET integrated database retrieval system