KEGG   Sphingobium sp. SYK-6: SLG_23310Help
Entry
SLG_23310         CDS       T01622                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssy00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ssy00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2514715..2515257)
Genome map
AA seq 180 aa AA seqDB search
MTALADIPLKTIRGAEASLADYAGKVLLIVNVASKCGLTPQYEGLEALHVAYRDKGLVVL
GFPANDFAGQEPGTNAEIESFCTTNFGVDFPMFEKLVATGPDKHPLYAELTAAIPQADND
GPFRERLRGYGMVPNAPPELLWNFEKFLVGRDGTVIARFAPDTRPDDPALVSAIEDALAA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcttgccgacatcccgctcaagaccattcgtggcgccgaggcttcgctggcg
gactatgccggcaaggtgctgctgatcgtgaacgtcgcgtccaaatgcggcctcaccccg
caatatgaggggctggaggcgctccatgtcgcctatcgggacaaggggctcgtcgtcctg
ggtttccccgccaatgatttcgcggggcaggagcccgggacgaacgcggagatcgagagt
ttctgcaccaccaatttcggcgtggattttcccatgttcgagaagctggtggcgacgggg
ccggacaagcacccgctttatgccgagctcaccgccgccatcccgcaggccgacaatgac
ggcccgttccgcgagcggctgcgcggctatggcatggtgcccaatgccccgcccgaactg
ctctggaatttcgagaagttcctcgtcggccgcgatggcaccgtgatcgcccgcttcgcg
ccggacacccggcccgatgatcccgcgctcgtctccgccatcgaggatgcgctggccgcc
tga

DBGET integrated database retrieval system