KEGG   Sphingobium sp. SYK-6: SLG_23310Help
Entry
SLG_23310         CDS       T01622                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SLG_23310
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SLG_23310
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SLG_23310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2514715..2515257)
Genome map
AA seq 180 aa AA seqDB search
MTALADIPLKTIRGAEASLADYAGKVLLIVNVASKCGLTPQYEGLEALHVAYRDKGLVVL
GFPANDFAGQEPGTNAEIESFCTTNFGVDFPMFEKLVATGPDKHPLYAELTAAIPQADND
GPFRERLRGYGMVPNAPPELLWNFEKFLVGRDGTVIARFAPDTRPDDPALVSAIEDALAA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcttgccgacatcccgctcaagaccattcgtggcgccgaggcttcgctggcg
gactatgccggcaaggtgctgctgatcgtgaacgtcgcgtccaaatgcggcctcaccccg
caatatgaggggctggaggcgctccatgtcgcctatcgggacaaggggctcgtcgtcctg
ggtttccccgccaatgatttcgcggggcaggagcccgggacgaacgcggagatcgagagt
ttctgcaccaccaatttcggcgtggattttcccatgttcgagaagctggtggcgacgggg
ccggacaagcacccgctttatgccgagctcaccgccgccatcccgcaggccgacaatgac
ggcccgttccgcgagcggctgcgcggctatggcatggtgcccaatgccccgcccgaactg
ctctggaatttcgagaagttcctcgtcggccgcgatggcaccgtgatcgcccgcttcgcg
ccggacacccggcccgatgatcccgcgctcgtctccgccatcgaggatgcgctggccgcc
tga

DBGET integrated database retrieval system