KEGG   Sphingobium sp. SYK-6: SLG_25300Help
Entry
SLG_25300         CDS       T01622                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SLG_25300
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_25300
  Lipid metabolism
   00071 Fatty acid degradation
    SLG_25300
  Amino acid metabolism
   00350 Tyrosine metabolism
    SLG_25300
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLG_25300
   00626 Naphthalene degradation
    SLG_25300
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SLG_25300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2734262..2735251
Genome map
AA seq 329 aa AA seqDB search
MALMHAMQLDAPGERLRPVARPLPEPAAGQIRLAISACGVCRTDLHVMDGDIHGVLPIIP
GHEIVGRVDALGPGVTGLAPGDRVGVPWLGHSCGTCRFCLNGQENLCDAPLFTGFTRDGG
YASHCIADARYCFPIPDMFDDVHAAPLLCAGLIGYRAYRLAGDAPTLGLYGFGAAAHILA
QLAIWQGRRVLAFTREGDARSQHFARALGCAWAGSSTQSSPEPLDAAIIFAPDGALVPRA
LKAVRKGGRVVCAGIHMSDIPAFPYADLWEERSILSVANLTRADGLAFLPLAARAAIRTS
VTALPLDQANEALDRLRRGDVDGALVLTM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatgcatgccatgcaactcgatgcgccgggcgaacggctgcgccccgtcgcg
cgcccgctgcccgagccggcggcggggcagatccgcctcgccatttccgcctgcggcgtc
tgccgcacggacctgcatgtgatggacggggacatccacggcgtcctgccgatcatcccg
gggcacgagatcgtcggccgcgtcgatgcgctcgggcccggcgtgaccggcctcgcgccc
ggtgaccgcgtcggcgtgccctggctcggccatagctgcggcacctgccgcttctgcctg
aacgggcaggagaatctgtgcgacgccccgctcttcaccggcttcacgcgcgatggcggc
tatgcgagtcattgcatcgcggacgcgcgctattgcttccccattccggacatgttcgac
gatgtccatgccgcaccgctgctctgcgcggggctgatcggctatcgcgcttaccggctt
gccggggatgcgcccacgctcgggctctatggcttcggcgccgccgcgcacatccttgcc
cagctcgccatctggcaggggcgccgcgtgctcgcctttacccgcgagggggacgcgcgc
agccagcatttcgcccgcgcgctcggctgcgcctgggccgggtcgtccacgcagtcctcg
cccgagccgctcgacgccgccatcatcttcgcgccggatggagcgctggtgccgcgcgcg
ctcaaggcggtccgcaagggcggacgcgtggtctgcgccggcatccacatgtccgacatc
ccggcctttccctatgccgatctgtgggaggagcgcagcatcctctccgtcgccaacctg
acgcgcgccgacgggctggcgttcctgcctctcgccgcccgggccgccatccgcaccagc
gtgacggcgctgccgctcgatcaggcgaacgaagcgctcgaccgcctgcggcgcggcgat
gtcgacggcgcgctcgtcctcaccatgtga

DBGET integrated database retrieval system