KEGG   Sphingobium sp. SYK-6: SLG_25320Help
Entry
SLG_25320         CDS       T01622                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SLG_25320 (recR)
DNA repair and recombination proteins [BR:ssy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SLG_25320 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2736098..2736694)
Genome map
AA seq 198 aa AA seqDB search
MSSPEIDALTQALARLPGLGPRSARRAVLHLLQKRETALAPLLRALESVNERMVQCAICG
NIDTIDPCGICADPRRDGRALCVVEDVADLWALEKSRLFPGRFHVLGGRLSALEGVRPED
LAIAPLVQRVAQGGIDEVVLAMNATLEGQTTAHYIAERLEAYPVRLTQLAHGVPIGGELD
YLDEGTLAQALRARRPID
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacccgagatcgacgcgctcacgcaggcgcttgcccggctccccggtctgggg
ccccgatccgcccggcgcgcggtgctgcatctcctgcagaagcgggagaccgcactggcg
ccgctgctgcgtgcgctcgaatccgtgaacgagcgtatggtccagtgcgccatctgcggc
aatatcgacacgatcgatccctgcggcatctgcgcggacccgcgccgcgacggacgcgcg
ctgtgcgtggtcgaggatgtggccgatctctgggcactggagaagtcgcgcctgttcccc
ggccgcttccatgtgctgggcgggcggctttccgcgctcgaaggggtgcgccccgaggat
ctggcgatcgcgccgctggtgcagcgggtcgcgcagggcggcatcgatgaagtcgtgctc
gcgatgaacgcgacgctcgaggggcagacgacggcgcactacatcgcggagcggctggaa
gcctatccggtgcggctgacccagcttgcccatggcgtgccgatcggcggcgagctcgat
tatctggacgaaggcacgctcgcgcaggccctgcgcgcccgccgcccgatcgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system