KEGG   Sphingobium sp. SYK-6: SLG_25820Help
Entry
SLG_25820         CDS       T01622                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLG_25820 (tpiA)
   01230 Biosynthesis of amino acids
    SLG_25820 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_25820 (tpiA)
   00051 Fructose and mannose metabolism
    SLG_25820 (tpiA)
   00562 Inositol phosphate metabolism
    SLG_25820 (tpiA)
Enzymes [BR:ssy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SLG_25820 (tpiA)
Exosome [BR:ssy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SLG_25820 (tpiA)
  Exosomal proteins of bladder cancer cells
   SLG_25820 (tpiA)
  Exosomal proteins of melanoma cells
   SLG_25820 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2793889..2794635)
Genome map
AA seq 248 aa AA seqDB search
MTGRRKLIAGNWKMNGLKAQLGEVSAIAELAAGRPDIDVALFLPATLISAAAPLAGTVLV
GGQDCHHEEAGAFTGCISAPMLLGAGAGGTLVGHSERRTYQHETNADVAAKAARASQHGL
EVVLCVGETLDTREQGDEAAHGWVVDQLLASLPEGAGSGWLTIAYEPVWAIGTGKVATPA
QVAAMHGALRAALVEALGADGQAMRILYGGSVSGDNAADILHLDNVDGALVGGASLSVAK
FAPIIAAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaggcgcaagctgatcgcgggaaactggaagatgaacgggctgaaggcgcag
ctcggcgaggtttcggccattgcggagctggctgcggggcgtccggatatcgacgtggcg
ctgtttctgcccgcgacgctcatttccgccgccgcgccgctcgccgggaccgtccttgtc
ggcgggcaggattgccatcatgaggaagcgggcgcgttcacgggatgcatctccgcaccc
atgctgttgggtgccggtgcgggcggcacgctcgtcggccacagcgaacggcgcacttat
cagcatgagaccaatgcggatgtcgccgccaaggccgcgcgcgccagccagcacgggctc
gaagtggtgctttgcgtgggcgagacgctcgatacgcgcgagcagggcgacgaggccgcc
catggctgggtggtcgatcagctgctggcatccttgccggaaggcgcgggttcgggctgg
ctgaccatcgcctatgagccagtctgggcgatcggcacaggcaaggtcgccacccccgcg
caggtcgccgccatgcatggcgcgcttcgtgccgctctggtggaagcgctgggcgcggac
gggcaggcgatgcgcattctctatggcggctcggtctcgggcgacaatgcggccgatatc
cttcatctcgacaatgtcgacggcgcgctggtcggcggcgccagcctctcggtcgcgaag
ttcgcgccgatcatcgcggcagcctga

DBGET integrated database retrieval system