KEGG   Sphingobium sp. SYK-6: SLG_25820Help
Entry
SLG_25820         CDS       T01622                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00010  Glycolysis / Gluconeogenesis
ssy00051  Fructose and mannose metabolism
ssy00562  Inositol phosphate metabolism
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01200  Carbon metabolism
ssy01230  Biosynthesis of amino acids
Module
ssy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssy_M00002  Glycolysis, core module involving three-carbon compounds
ssy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_25820 (tpiA)
   00051 Fructose and mannose metabolism
    SLG_25820 (tpiA)
   00562 Inositol phosphate metabolism
    SLG_25820 (tpiA)
Enzymes [BR:ssy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SLG_25820 (tpiA)
Exosome [BR:ssy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SLG_25820 (tpiA)
  Exosomal proteins of bladder cancer cells
   SLG_25820 (tpiA)
  Exosomal proteins of melanoma cells
   SLG_25820 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAK67257
NITE: SLG_25820
UniProt: G2IJ87
Position
complement(2793889..2794635)
Genome map
AA seq 248 aa AA seqDB search
MTGRRKLIAGNWKMNGLKAQLGEVSAIAELAAGRPDIDVALFLPATLISAAAPLAGTVLV
GGQDCHHEEAGAFTGCISAPMLLGAGAGGTLVGHSERRTYQHETNADVAAKAARASQHGL
EVVLCVGETLDTREQGDEAAHGWVVDQLLASLPEGAGSGWLTIAYEPVWAIGTGKVATPA
QVAAMHGALRAALVEALGADGQAMRILYGGSVSGDNAADILHLDNVDGALVGGASLSVAK
FAPIIAAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaggcgcaagctgatcgcgggaaactggaagatgaacgggctgaaggcgcag
ctcggcgaggtttcggccattgcggagctggctgcggggcgtccggatatcgacgtggcg
ctgtttctgcccgcgacgctcatttccgccgccgcgccgctcgccgggaccgtccttgtc
ggcgggcaggattgccatcatgaggaagcgggcgcgttcacgggatgcatctccgcaccc
atgctgttgggtgccggtgcgggcggcacgctcgtcggccacagcgaacggcgcacttat
cagcatgagaccaatgcggatgtcgccgccaaggccgcgcgcgccagccagcacgggctc
gaagtggtgctttgcgtgggcgagacgctcgatacgcgcgagcagggcgacgaggccgcc
catggctgggtggtcgatcagctgctggcatccttgccggaaggcgcgggttcgggctgg
ctgaccatcgcctatgagccagtctgggcgatcggcacaggcaaggtcgccacccccgcg
caggtcgccgccatgcatggcgcgcttcgtgccgctctggtggaagcgctgggcgcggac
gggcaggcgatgcgcattctctatggcggctcggtctcgggcgacaatgcggccgatatc
cttcatctcgacaatgtcgacggcgcgctggtcggcggcgccagcctctcggtcgcgaag
ttcgcgccgatcatcgcggcagcctga

DBGET integrated database retrieval system