KEGG   Sphingobium sp. SYK-6: SLG_28000Help
Entry
SLG_28000         CDS       T01622                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ssy00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ssy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3021928..3023328)
Genome map
AA seq 466 aa AA seqDB search
MMTRIALTAALVLAAQPVLAQEQAPDLARAARGDLREPGGARRLAGDMRAAYRTLAAEGE
VRNVILLIGDGMGDSEITIARNYAEGAGGYFKGIDALPFTGQYTHYSLERETGKPDYVTD
SAASATAWASGVKSYNGAIGVDIHGKPHATLIELARKAGLATGNVSTAEIQDATPAALLA
HVAFRSCYGPTATSKTCPQNALENGGAGSITEQLLDTRADLVLGGGAASFAEMAKAGQWK
GKTLFEQASARGYRIVRNAAELEAITRADDRQPLIGLFSEGNMPVRWTGPRASLHGNIDK
PAITCQPNAARNETIPTLATMTSKAIALLKPKGFFLQVEGASIDKQDHAANPCGQIGETV
DLDEAVQVALAFAKADGHTLVIVTADHAHTSQIVGNGTRSSGLTAALNTREGGVMTVNYG
TAEEGSQGHTGAQLRIAAYGPQAVNVSGLLDQTDLHYIVRDALKLD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccgtatcgctctgactgccgcactcgtgctcgcggcccagcctgttctcgcg
caggagcaggcgcctgacctggcgcgcgcggcgcggggcgatctgcgcgaaccgggcggg
gcgcggcgcctcgccggtgatatgcgcgcggcctatcgcacgctggctgccgagggcgaa
gtgcgcaacgtcatcctgctgattggcgatggcatgggggattcggagatcaccatcgcg
cgcaattatgccgagggcgccggcggctatttcaagggcatcgatgcgctgcctttcact
ggccagtacacccattattcgctcgagcgcgagaccggcaaacccgattatgtgacggat
agcgctgcctccgccaccgcctgggcgtcgggcgtgaaaagctataatggcgcgatcggc
gtcgatatccatggcaagccccatgcaacgctgatcgagctggccaggaaagccggtctt
gccaccggcaatgtctcgacggccgagatccaggatgcaacgccagccgcgctgctggcc
cacgtcgctttccgcagctgctacgggccgaccgcgaccagcaagacctgtccgcagaat
gcgctggaaaatggcggggccggctcgatcaccgagcaactgctcgatacccgcgccgat
ctcgtgctcggcggcggtgcggcgagtttcgcggagatggcgaaggcgggtcaatggaaa
ggcaagacgctgttcgagcaggccagcgcgcggggctaccggatcgtgcgcaacgctgcg
gaactcgaggccatcacgcgcgccgatgacaggcagccgctgatcggcctgttctcggaa
ggcaatatgccggtccgctggacgggcccgcgcgccagccttcacggcaatatcgacaag
ccggccatcacttgccagcccaatgccgcgcgcaatgaaaccataccgacgctcgcgacg
atgaccagcaaggcgatcgcgctcctgaagcccaaaggcttcttccttcaggtcgaaggc
gcgtcgatcgacaaacaggaccacgcggccaatccctgcgggcagatcggcgagacggtc
gatctggacgaggcggtccaggtcgcgctggccttcgcgaaggcggatggccacacgctg
gtcatcgtcacggctgaccatgcccacaccagccagatcgtgggcaacggcacccgctca
tccggcctgactgcggcactgaacacgcgggagggcggtgtcatgacagtgaactacggc
accgcggaggaaggatcgcaaggccacacaggcgcgcagctgcgcatcgccgcttatggc
ccgcaggccgtcaatgtcagcggcctgctcgatcagaccgatctccactacatcgtgcgg
gacgcgctcaagctggattga

DBGET integrated database retrieval system