KEGG   Sphingobium sp. SYK-6: SLG_29350Help
Entry
SLG_29350         CDS       T01622                                 

Definition
(GenBank) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ssy  Sphingobium sp. SYK-6
Brite
Enzymes [BR:ssy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     SLG_29350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(3183033..3184193)
Genome map
AA seq 386 aa AA seqDB search
MSAPNASSDKPGGTLAKLGRIFGIGETLPNEGEISVAGERETGSGHMRREVERRKALYAD
VGDFLFAHDLDITPLNFGLALDYITGNDVAIEKAVRAILSDRGRITNGVAEQIIADQRAE
DLTPDSLTDMLSEMEANLNQITGIANQSSTSAKDFGAALQAQAAELSKEDAGGETIANLV
SLTRSMIEKTREVESRMREGQKQTRLLQKNLENARKAAEQDHLTGLPNRRAFESTLREEC
ALARENGEPLSVAFCDIDHFKAVNDTHGHDAGDRVLKFVAGLLAKVSGDKCHVARHGGEE
FVLLFRGLPVAEAAKVVDDARADMASRNLVDRKTGERMDQVTFSGGVADMFAHPEPRDAL
RAADRALYLAKEHGRNRVYIAREPEQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccgaatgcgtcgtccgataaaccaggtggcaccctggccaagcttggccgt
atcttcgggattggggaaaccttgccgaacgagggcgagatatccgtcgcgggagagcgc
gaaacgggcagtggccacatgcggcgcgaggtggagcgccggaaggccctgtatgcggat
gtcggagatttcctcttcgcgcatgacctcgatatcacgccgctcaatttcggcctcgcg
ctcgattatatcaccggcaacgacgtcgcgatcgagaaggcggtgcgcgccatcctgagc
gacaggggacgcatcaccaacggtgtcgccgaacagatcattgccgaccagcgggccgag
gacctgacacccgattcgctcacggacatgctttccgagatggaagcgaacctgaaccag
atcacgggcatcgccaatcagtcgagcacgtccgccaaggatttcggcgcggcgctgcag
gcgcaggcggccgagctgagcaaggaggatgccggcggcgagacgatcgccaatctggtg
tcgctgacccgcagcatgatcgagaagacgcgcgaggtggaaagccggatgcgcgagggg
cagaagcagacgcggctgctccagaagaatctcgaaaatgcccgcaaggcggcggagcag
gaccatctgaccggcctgccgaaccgccgcgccttcgagagcacgctgcgcgaggaatgc
gccctcgcgcgggagaatggcgagccgctcagcgtcgccttctgcgacatcgatcatttc
aaggcggtcaacgacacccacggacatgatgccggcgaccgcgtgctcaagttcgtcgcc
gggctgctcgccaaggtctcgggcgacaagtgccatgtggcgcggcatggcggcgaggag
ttcgtgctgctcttccggggcctgcccgtcgccgaggccgccaaggtggtcgacgatgcg
cgcgccgacatggccagccggaacctcgtcgatcgcaagaccggcgagcgcatggaccag
gtgaccttttcaggtggcgtggcggacatgttcgcgcaccccgaaccgcgcgatgcgctg
cgggccgcggaccgggcactttacctcgccaaggaacatggccgtaatcgcgtctatatc
gcccgcgaacccgagcaataa

DBGET integrated database retrieval system