KEGG   Sphingobium sp. SYK-6: SLG_30900Help
Entry
SLG_30900         CDS       T01622                                 

Definition
putative phosphodiesterase/alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SLG_30900
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SLG_30900
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SLG_30900
Enzymes [BR:ssy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SLG_30900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3335118..3336800)
Genome map
AA seq 560 aa AA seqDB search
MKVDRRRALGLFGSGAILPVAAARAQGPGNASFRHGVASGDPSRDGAVLWTRVTPGDPDH
AGALPVRWFVAATPEGKPIEHGSAEARPARDFTVKVQPRRLKAGRDYVYWFELADGTRSP
VGRFRTLPAGETADLVLAVASCQLFPGGFFNAWDSVARLERLDAVIHLGDYIYEYGAEGY
GAAIGSKIGRSVEPPHEIVTLADYRMRHAQYKSDPALQAAHARAAFICVWDDHETANDAW
LHGAENHQPEREGQWADRKAAAMQAYFEWMPIRDPAPGAPWDAINRSFTFGDLATLAMVE
TRLLARSEQAGFKGATPAAEDIAAVLAERNRPDRELLGEPQRAWLERELTASVAAGVPWQ
LIGNQVVMARVNGPDLAALLGAERAAGAIGGLDAATRAQVEAAQAGYRAGLPFNLDAWDG
YPAARERLYDSFRRAGSQPLILSGDSHAFWANALADQQGEPVAVEFGTSGISSPSVGDAI
PQLPLGDFLTRSSPEVAFCDQRAKGYTLLRLTREAAVADYVAMSTIFARDYEARLLARFE
VAAAAQPRVLKRASANAEGG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgatcgtcgccgcgcgctcggcctgttcggctcgggcgccatcctccccgtc
gcggccgcgcgcgcgcagggccccgggaacgcatccttccgccacggcgtcgccagtggc
gatccctcgcgagacggggcagtgctgtggacgcgcgtaacgccgggcgatccggatcat
gccggcgcccttcccgtccggtggttcgtcgccgccacgccggagggaaaaccgatcgag
cacgggtccgccgaagcaaggcccgcgcgcgatttcacggtgaaggtccagccgcgccgc
ctaaaggcggggcgggactatgtctactggttcgagctggcggacggcacgcgttcgcca
gtgggccggttccgcacattgccagcgggcgagacggccgacctcgttctcgcggtcgcg
agttgccagctctttcccggcgggttcttcaatgcctgggattcggtcgcgcggctcgag
cggctggatgcggtcatccatctgggcgactatatctatgaatatggcgcggagggatat
ggcgccgcgatcggcagcaagatcggccgctctgtcgaaccgccgcacgagatcgtgaca
ctggccgactatcgcatgcgccatgcgcagtacaagagcgaccccgcgctccaggcggca
catgcccgcgcggccttcatctgcgtgtgggacgatcatgagaccgccaacgatgcgtgg
ctgcacggtgcggagaatcaccagccggagcgcgagggccagtgggcggaccgcaaggcc
gctgccatgcaggcctatttcgaatggatgccgatccgcgatcctgcccccggggcgcca
tgggacgcgatcaatcgcagcttcaccttcggcgatctggcgacactcgcgatggtcgag
acgcgcttgctggcgcggtcggagcaggccggtttcaagggcgcgacgccggccgccgag
gacatcgccgctgtccttgccgaacgcaaccgtccggatcgcgaattgctcggcgaaccc
cagcgcgcctggctcgaacgggaactcacggcatcggtggcggcgggcgtgccctggcaa
ctgatcggcaatcaggtggtgatggcgcgcgtgaacgggccggaccttgcggccctgctc
ggcgcggagcgtgcggcgggtgccatcgggggactggacgcagccacgcgcgcgcaggtg
gaggccgcacaggcgggctatcgggccggactgccgttcaatctcgacgcgtgggacggc
tatcccgccgcgcgggagcggctctatgacagcttccggcgcgccggatcacagccgctg
atactctcgggcgacagccatgccttctgggccaacgcgcttgccgatcagcagggagag
ccggttgcggtggagttcggaaccagcggcatcagcagcccctccgtgggcgacgcgatc
ccgcaactgccgctcggcgacttcctcacgcggtccagtccggaagttgccttctgcgac
cagcgggccaagggttacaccctgctccggctgacgcgcgaggcggcagtggccgattat
gtcgcgatgtcgaccatctttgcgcgggattatgaagcccgcctgctcgcgcgcttcgaa
gtcgctgcggcggcgcagccccgggtgctgaagcgggcttcggcgaacgctgaagggggt
tag

DBGET integrated database retrieval system