KEGG   Sphingobium sp. SYK-6: SLG_31480Help
Entry
SLG_31480         CDS       T01622                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ssy  Sphingobium sp. SYK-6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3406887..3407540
Genome map
AA seq 217 aa AA seqDB search
MSEQNFQAMRRAMVESQLRTNDVNDPAIIEAILAEPREAYVPAERRAAAYTDRAVPLGNG
RALNPALATARLLVEVAPRAGQRVLLIGAATGYAAALLARLGCVVVAIEEDPVLAEQAAR
QLGDRPGITLHAGPLAAGWPEGAPYDLLFVDGAVEELADALIQQLKVDGRAAFATAERGV
TRLCAGARSAGGFGARAFADSEAVILPGFARPKAFTF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagaatttccaggcaatgcgccgcgcaatggtggaaagccagttgcgcacg
aacgacgtgaatgatccggcgatcatcgaggcgattctcgccgagccgcgtgaggcttat
gtgccggcggaacgccgggccgcagcctataccgaccgcgccgtgccactgggcaacggc
cgcgcgctcaatccggcgctggccacggcccgcctgctcgtggaagtggcgccccgcgcg
ggccagcgcgtgcttctgatcggtgcggcgacgggctatgcggcggcgctgctggcgcgg
ctgggctgcgtcgtcgtggcgatcgaggaagatccggttctggccgagcaggccgcacgg
cagttgggcgatcgcccgggcattacccttcacgccggcccgctggccgcgggatggccg
gaaggcgcgccttatgacctgctgttcgtcgatggcgcggtggaagagctggccgatgcg
ctgatccagcagctcaaggtggacgggcgcgcggccttcgcaactgcggaacgcggcgtt
acgcgcctttgcgccggtgcgcgctcggcgggcggctttggcgcgcgggcattcgcggac
agcgaagcggtcatcctgcccggtttcgcccggcccaaagccttcactttctga

DBGET integrated database retrieval system