KEGG   Sphingobium sp. SYK-6: SLG_32100Help
Entry
SLG_32100         CDS       T01622                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ssy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssy00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssy00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssy00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssy00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ssy00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3475481..3476452
Genome map
AA seq 323 aa AA seqDB search
MTQIIAADVGGTNARFARATLDADGVPTLGTVRKYKVADYPSLAACWRAYQREEGGDLPD
RLSIAFAAPIARETIKLTNSSWMVRPASLAADLGLACVRLVNDFEAVAHAVARLPMRDLP
LLFGPEKPFPTDGGVTILGPGTGLGVGLVAFDDGVPHIVATEGGHVDFAPLDALEGRILD
LLRADFVRVSTERIVSGPGLNNLYKALATLSHEPVTLWSDADLWAAALDGSNPLARSALE
RFCLSYGAVAGDLALAHGPHQVVLAGGLTQRMRDFLVNQSGFHSRFTAKGRYEGLMRTIP
VRLAIHPEIGLYGAAAAWREKKA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagatcatcgcggccgatgtcgggggcaccaatgcccgctttgcccgcgccacg
ctggatgccgatggcgtgcccacgctcggcaccgtgcgcaagtacaaggtggcggattat
cccagcctcgcggcctgctggcgtgcctatcagcgcgaggaaggcggcgacctgcccgac
cggctttccatcgccttcgccgcgccgatcgcgcgggagaccatcaaactcaccaattcg
agctggatggtccgcccggccagcctggccgccgatctcggccttgcctgcgtccggctg
gtcaatgacttcgaggccgtcgcccatgccgtggcgcggctaccgatgcgcgacctgccg
ctgctgttcgggccggagaagcccttccccaccgatggcggcgtcaccatcctcggcccc
ggcacgggcctcggcgtcgggctcgtcgcgttcgacgatggcgtgccacacatcgtcgcc
accgagggcggccatgtcgatttcgcgccgctcgatgcgctggaaggccgcatcctcgat
ctcctgcgcgccgatttcgtccgcgtgtccaccgagcggatcgtctcggggcccggcctc
aacaatctctacaaggcactggcaacgctcagccacgagccggtcaccctgtggtccgat
gccgatctctgggcggcggcgctggacggcagcaatccgctggcccgctccgcgctggaa
cgcttctgcctttcttatggcgccgtggcgggtgatctggcgctcgcgcatggcccgcat
caggtcgtgctggccggcggcctcacccagcggatgcgcgacttcctggtcaaccagagc
ggcttccacagtcgcttcaccgccaagggccgctatgaagggctgatgcggacgatcccg
gtccgcctcgccatccaccccgagatcggcctttacggcgcagccgccgcctggcgcgag
aagaaagcatga

DBGET integrated database retrieval system