KEGG   Sphingobium sp. SYK-6: SLG_33650Help
Entry
SLG_33650         CDS       T01622                                 

Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssy01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ssy00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ssy00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3634337..3635560)
Genome map
AA seq 407 aa AA seqDB search
MNANLTADRPTFVTHLECSLTGERYAADQLHGLSRAGRPLLVRYDLDAVAAAVSRDALAA
RETDLWRWRELLPVRRTENIVSLGEVETPLVPIARSGGPGVLVKDEGRLPTGSFKARGLV
MAVAMARELGVTRIAMPTNGNAGAALAAYATRCGIETIVLCPEDTPEVNVREIALQGARV
WRVNGLIDDCGAIVGKGAAEGRWFDFSTLKEPYRIEGKKTMGLELAAQFGWELPDAIFYP
TGGGTGLIGMWKAFDELERLGWIGSKRPRMYAVQAAGCAPIVKAFEDGVEHAERWEDAST
VAAGIRVPRAVGDFLILRAVRESGGRALAVDDGEILRAVDDAARQDGLLLCPEGGATLAA
YRQAKADGLVGADERVVLFNCATGLKYPMPPADNWLDRHGEIDFDAL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaatctgacagccgaccgcccgaccttcgtcacgcatctggaatgctcgctc
accggtgagcgctatgcggcggaccagcttcacggcctgtcccgcgccgggcggccgttg
ctggtgcgctatgatctggatgccgtcgccgccgccgtctcgcgggacgcgctcgcagcc
cgggaaacggacctgtggcgctggcgcgaattgctgccggtgcggcgcacggagaatatc
gtttccttaggggaggtcgagacgccgctggtgcccatcgcccggtccggtggccccggc
gtgctggtgaaggacgaggggcggctccccaccggttccttcaaggcgcgcgggctggtg
atggccgtcgccatggcccgcgagctcggcgtcacccgcatcgccatgccgaccaatggc
aatgccggcgccgctctggcggcttatgccacgcgctgcggcatcgagacgatcgtgctg
tgcccggaggatacgccggaagtgaatgtgcgcgagatcgcactccagggtgcgcgcgtc
tggcgcgtcaacggcctgatcgacgattgcggcgccatcgtcggcaagggcgccgcggaa
gggcgctggttcgatttctcgactctcaaggagccctaccggatcgagggcaagaagacg
atggggctggagcttgccgcgcagttcggctgggagctcccggatgcgatcttctacccg
accggtggcggcacggggctcatcggcatgtggaaggcgttcgacgagctggaaaggctc
ggctggatcggatcgaagcggccgcgcatgtatgcggtgcaggcggccggctgcgcgccg
atcgtcaaggccttcgaggacggcgtcgagcatgccgagcgctgggaggatgcgtcaacc
gtcgcggccggcatccgcgtgccgcgcgccgtgggcgatttcctcatcctgcgcgccgtc
cgcgaatcgggcgggcgcgccctggccgtggacgatggcgagatcctgcgcgcggtggac
gatgccgcccgtcaggatgggctcctcctctgcccggaaggcggcgcgacgctcgcggct
taccggcaggcgaaggcggacggcctcgtgggtgcggacgagcgcgtcgtcctgttcaat
tgcgcgaccggcctcaaatatcccatgccgcccgcggacaactggctggaccgccacggc
gagatcgatttcgacgccctctga

DBGET integrated database retrieval system