KEGG   Sphingobium sp. SYK-6: SLG_34230Help
Entry
SLG_34230         CDS       T01622                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00040  Pentose and glucuronate interconversions
ssy00052  Galactose metabolism
ssy00500  Starch and sucrose metabolism
ssy00520  Amino sugar and nucleotide sugar metabolism
ssy01100  Metabolic pathways
ssy01130  Biosynthesis of antibiotics
Module
ssy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SLG_34230
   00052 Galactose metabolism
    SLG_34230
   00500 Starch and sucrose metabolism
    SLG_34230
   00520 Amino sugar and nucleotide sugar metabolism
    SLG_34230
Enzymes [BR:ssy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SLG_34230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAK68098
NITE: SLG_34230
UniProt: G2IPB7
Position
3699995..3700876
Genome map
AA seq 293 aa AA seqDB search
MGGNRLKIRKAVFPVAGLGTRFLPATKAVPKEMLPVVDRPLIQYAVDEALEAGIETMIFV
TGRNKGAIEDHFDIAYELERTQADRGKSVDALAGTRLTPGNAIFVRQQEPRGLGHAIWCA
RDIVGDEPFAIILPDELLIGREKGCLAQMVAQYEKVGGNLVCALEVPMEDTPSYGVIDPG
ARDGVLTEVKGLVEKPSLGTAPSNLMLPGRYILQPEVMALLATQEAGAGGEVQLTDSMAK
LIGQQPFHGVTFDGERFDCGSKLGFAQANFALACRDGAMGKDLQSWAKALLAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggggggtaacaggttgaaaatccgcaaagccgtttttcctgtcgccggtctcggcacc
cgttttcttcctgcaaccaaggctgtccccaaggaaatgctgccggtcgtcgaccggccg
ctgatccagtatgcggtggacgaagcgctggaagcgggcatcgagacgatgatcttcgtc
accgggcgcaacaagggcgcgatcgaggaccatttcgacatcgcctatgagctggagcgc
acgcaggcggaccggggcaagagcgtggacgcgctcgccggcacacggctgacgccgggc
aacgccatcttcgtgcgccagcaggagccgcgcggcctcggccatgcgatctggtgcgcg
cgcgacatcgtgggagacgagcccttcgcgatcatcctgcccgacgagctgctgatcggc
cgcgaaaagggctgccttgcccagatggtcgcgcaatatgagaaggtcggcggcaacctc
gtgtgcgcgctcgaagtgccgatggaggatacgccgagctacggcgtcatcgacccgggt
gcgcgcgacggcgtgctgaccgaagtgaagggcctcgtcgagaagcccagcctcggcacc
gcgccttccaacctcatgctgccagggcgctacatcctccagcccgaagtgatggccctg
ctcgccacgcaggaagccggcgcgggcggcgaagtgcagctcaccgattcgatggcgaag
ctgatcggccagcagcccttccacggggtgacgttcgacggtgagcgcttcgactgcggc
tccaagctcggcttcgcgcaggcgaacttcgcgctcgcctgccgtgacggggccatgggc
aaggacctgcaatcctgggcgaaggcgctgctggcgtcatga

DBGET integrated database retrieval system