KEGG   Sphingobium sp. SYK-6: SLG_34230Help
Entry
SLG_34230         CDS       T01622                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SLG_34230
   00052 Galactose metabolism
    SLG_34230
   00500 Starch and sucrose metabolism
    SLG_34230
   00520 Amino sugar and nucleotide sugar metabolism
    SLG_34230
Enzymes [BR:ssy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SLG_34230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3699995..3700876
Genome map
AA seq 293 aa AA seqDB search
MGGNRLKIRKAVFPVAGLGTRFLPATKAVPKEMLPVVDRPLIQYAVDEALEAGIETMIFV
TGRNKGAIEDHFDIAYELERTQADRGKSVDALAGTRLTPGNAIFVRQQEPRGLGHAIWCA
RDIVGDEPFAIILPDELLIGREKGCLAQMVAQYEKVGGNLVCALEVPMEDTPSYGVIDPG
ARDGVLTEVKGLVEKPSLGTAPSNLMLPGRYILQPEVMALLATQEAGAGGEVQLTDSMAK
LIGQQPFHGVTFDGERFDCGSKLGFAQANFALACRDGAMGKDLQSWAKALLAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggggggtaacaggttgaaaatccgcaaagccgtttttcctgtcgccggtctcggcacc
cgttttcttcctgcaaccaaggctgtccccaaggaaatgctgccggtcgtcgaccggccg
ctgatccagtatgcggtggacgaagcgctggaagcgggcatcgagacgatgatcttcgtc
accgggcgcaacaagggcgcgatcgaggaccatttcgacatcgcctatgagctggagcgc
acgcaggcggaccggggcaagagcgtggacgcgctcgccggcacacggctgacgccgggc
aacgccatcttcgtgcgccagcaggagccgcgcggcctcggccatgcgatctggtgcgcg
cgcgacatcgtgggagacgagcccttcgcgatcatcctgcccgacgagctgctgatcggc
cgcgaaaagggctgccttgcccagatggtcgcgcaatatgagaaggtcggcggcaacctc
gtgtgcgcgctcgaagtgccgatggaggatacgccgagctacggcgtcatcgacccgggt
gcgcgcgacggcgtgctgaccgaagtgaagggcctcgtcgagaagcccagcctcggcacc
gcgccttccaacctcatgctgccagggcgctacatcctccagcccgaagtgatggccctg
ctcgccacgcaggaagccggcgcgggcggcgaagtgcagctcaccgattcgatggcgaag
ctgatcggccagcagcccttccacggggtgacgttcgacggtgagcgcttcgactgcggc
tccaagctcggcttcgcgcaggcgaacttcgcgctcgcctgccgtgacggggccatgggc
aaggacctgcaatcctgggcgaaggcgctgctggcgtcatga

DBGET integrated database retrieval system