KEGG   Sphingobium sp. SYK-6: SLG_36390Help
Entry
SLG_36390         CDS       T01622                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
ssy  Sphingobium sp. SYK-6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3915277..3916239)
Genome map
AA seq 320 aa AA seqDB search
MAQEAIRFLDAHMLDATPTNYTFAYLYLTGANGWLRKAVDGIIEGGVRLAQKEVDGLMEL
APGETGHGAAASSLATEEEHRARLRLQMLSFSDLTAQAISSAGSFGRDLAQRADMIGGAS
DLGGLVAAMLERTAEMERRLAETRLETERLRQDLDAARDDATRDALTNLPNRRAIDRQLR
LFAEQGTQIALAFCDIDHFKSINDRFGHAVGDRVLKVVAETLSATMDPHIVGRFGGEEFV
VVLPQVDAETAFALVEKARAAVSSRNMRVRDTDEPLGQVTFSAGIALCRNDPEAALRQAD
DLLYEAKNSGRNRTIYKVAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaggcgatccgcttcctcgatgcgcatatgctggatgcgacgccgaccaac
tacaccttcgcctatctctatctgaccggggccaatggctggctccgcaaggcggtcgat
ggcatcatcgagggcggcgtgcggcttgcccagaaggaagtcgacgggctcatggagctt
gcgccgggcgaaacgggccatggggctgcggcatcctcgctggccacggaggaagagcat
cgcgccaggctgcggctccagatgctgtctttcagtgatctcaccgcgcaagccatcagc
agtgccggttcgttcggccgcgatctcgcgcaacgcgccgacatgatcggcggggcgtcc
gatcttggtggactcgtcgctgccatgctcgaacggacggccgagatggagaggcgcctc
gccgagacgcggctcgagaccgagcgcctgcggcaggaccttgatgccgcgcgcgacgat
gcgacccgcgacgcgctcaccaatctgcccaatcgccgcgccatcgaccggcagcttcgc
ctcttcgcggagcagggcacgcagattgcgctggcattttgcgatatcgatcatttcaag
tcgatcaatgatcgcttcggccatgcggtcggggatcgggtgctcaaggtcgtggccgag
acgctgtccgcgaccatggatccccatatcgttggtcgcttcggcggcgaggagttcgtc
gtcgtcctgccccaggtcgatgcggaaacggccttcgcgctggtcgagaaggcgcgcgcg
gccgtcagctcccgcaacatgcgcgttcgcgataccgacgagccgcttggccaggtgact
ttctcggcgggcatcgccctgtgccgtaacgatcccgaagccgcgctgcggcaggccgat
gatctcctctacgaagccaagaacagcggccgcaaccggacgatctacaaggtcgccgcg
tag

DBGET integrated database retrieval system