KEGG   Sphingobium sp. SYK-6: SLG_36390Help
Entry
SLG_36390         CDS       T01622                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ssy  Sphingobium sp. SYK-6
Brite
Enzymes [BR:ssy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     SLG_36390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(3915277..3916239)
Genome map
AA seq 320 aa AA seqDB search
MAQEAIRFLDAHMLDATPTNYTFAYLYLTGANGWLRKAVDGIIEGGVRLAQKEVDGLMEL
APGETGHGAAASSLATEEEHRARLRLQMLSFSDLTAQAISSAGSFGRDLAQRADMIGGAS
DLGGLVAAMLERTAEMERRLAETRLETERLRQDLDAARDDATRDALTNLPNRRAIDRQLR
LFAEQGTQIALAFCDIDHFKSINDRFGHAVGDRVLKVVAETLSATMDPHIVGRFGGEEFV
VVLPQVDAETAFALVEKARAAVSSRNMRVRDTDEPLGQVTFSAGIALCRNDPEAALRQAD
DLLYEAKNSGRNRTIYKVAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaggcgatccgcttcctcgatgcgcatatgctggatgcgacgccgaccaac
tacaccttcgcctatctctatctgaccggggccaatggctggctccgcaaggcggtcgat
ggcatcatcgagggcggcgtgcggcttgcccagaaggaagtcgacgggctcatggagctt
gcgccgggcgaaacgggccatggggctgcggcatcctcgctggccacggaggaagagcat
cgcgccaggctgcggctccagatgctgtctttcagtgatctcaccgcgcaagccatcagc
agtgccggttcgttcggccgcgatctcgcgcaacgcgccgacatgatcggcggggcgtcc
gatcttggtggactcgtcgctgccatgctcgaacggacggccgagatggagaggcgcctc
gccgagacgcggctcgagaccgagcgcctgcggcaggaccttgatgccgcgcgcgacgat
gcgacccgcgacgcgctcaccaatctgcccaatcgccgcgccatcgaccggcagcttcgc
ctcttcgcggagcagggcacgcagattgcgctggcattttgcgatatcgatcatttcaag
tcgatcaatgatcgcttcggccatgcggtcggggatcgggtgctcaaggtcgtggccgag
acgctgtccgcgaccatggatccccatatcgttggtcgcttcggcggcgaggagttcgtc
gtcgtcctgccccaggtcgatgcggaaacggccttcgcgctggtcgagaaggcgcgcgcg
gccgtcagctcccgcaacatgcgcgttcgcgataccgacgagccgcttggccaggtgact
ttctcggcgggcatcgccctgtgccgtaacgatcccgaagccgcgctgcggcaggccgat
gatctcctctacgaagccaagaacagcggccgcaaccggacgatctacaaggtcgccgcg
tag

DBGET integrated database retrieval system