KEGG   Sphingobium sp. SYK-6: SLG_p_00690Help
Entry
SLG_p_00690       CDS       T01622                                 

Gene name
adh
Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SLG_p_00690 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_p_00690 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SLG_p_00690 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SLG_p_00690 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLG_p_00690 (adh)
   00626 Naphthalene degradation
    SLG_p_00690 (adh)
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SLG_p_00690 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pSLPG:66084..67109
Genome map
AA seq 341 aa AA seqDB search
MAKTMKAAVVREFGKPLVIEDAPIPTVGPGQILVKIAATGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVAAVGAGVTHVKEGDRVGVPWLYTACGHCVHCLGGWETLCHEQQNTGYSV
NGSFAEYVLADPNYVGHLPDNVDFLDIAPILCAGVTVYKGLKATEARPGEWVVVSGIGGL
GHMAVQYARAMGLNVAAVDIDDSKLDLATRLGATLTVNAHSEDPSAALKKAIGGAHGALV
TAVSPKAFQQALGMVRRGGTVALNGLPPGDFPLSIFDTVLNGITVRGSIVGTRLDLLEAL
AFAGDGKVKATVHADKLENINDVFSRMHHGDIEGRIVLDLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaccatgaaggcggcggtcgtccgcgaattcggcaagcccctggtcatcgag
gacgcgccgatcccgacggtcggccccgggcagatcctggtcaagattgcggcaaccggc
gtgtgccataccgacctgcacgcggcagaaggggactggccggtcaaacccaacccgccc
ttcattcctggccatgaaggcgtcgggcatgtcgccgccgtcggtgcgggcgtcacccat
gtgaaggaaggcgaccgggtcggcgtgccctggctctacaccgcctgcgggcattgcgtg
cattgcctgggtggctgggagacgctttgccacgaacagcagaacaccggctattcggtc
aatggcagctttgccgaatatgtcctcgccgatcccaactatgttggtcaccttcccgac
aatgtcgacttcctcgacattgcgccgatcctctgcgcgggcgtcaccgtctacaaggga
ttgaaggccaccgaggcccgacccggcgagtgggtggtcgtctcagggatcggcgggctc
ggccacatggcggtgcaatatgcccgtgccatgggtctcaatgtggccgcggtcgacatc
gacgatagcaagctcgacctcgctacacgccttggcgccacactgacggtcaacgcgcac
agcgaggacccttcggcagcgctcaagaaggcgataggcggcgcgcacggagcgctcgtc
accgccgtttcgcccaaggcgttccagcaggcgctcggcatggtccggcgcggcggcacg
gtcgcgctcaatggtctgccgccgggcgacttcccgctgtcgatcttcgacaccgtgctg
aacggcattaccgtgcgaggctcgatcgtcggcacgcggctcgatctgctcgaggcactg
gcgttcgccggcgacggcaaggtcaaggccacggtccatgcagacaagctggagaacatc
aacgacgtcttctcccgcatgcaccatggcgacatcgagggccggatcgtcctcgacctc
gcctga

DBGET integrated database retrieval system