KEGG   Sphingobium sp. SYK-6: SLG_p_00690Help
Entry
SLG_p_00690       CDS       T01622                                 

Gene name
adh
Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00010  Glycolysis / Gluconeogenesis
ssy00071  Fatty acid degradation
ssy00350  Tyrosine metabolism
ssy00625  Chloroalkane and chloroalkene degradation
ssy00626  Naphthalene degradation
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_p_00690 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SLG_p_00690 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SLG_p_00690 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLG_p_00690 (adh)
   00626 Naphthalene degradation
    SLG_p_00690 (adh)
Enzymes [BR:ssy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SLG_p_00690 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: BAK68657
NITE: SLG_p_00690
UniProt: G2ITY2
Position
pSLPG:66084..67109
Genome map
AA seq 341 aa AA seqDB search
MAKTMKAAVVREFGKPLVIEDAPIPTVGPGQILVKIAATGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVAAVGAGVTHVKEGDRVGVPWLYTACGHCVHCLGGWETLCHEQQNTGYSV
NGSFAEYVLADPNYVGHLPDNVDFLDIAPILCAGVTVYKGLKATEARPGEWVVVSGIGGL
GHMAVQYARAMGLNVAAVDIDDSKLDLATRLGATLTVNAHSEDPSAALKKAIGGAHGALV
TAVSPKAFQQALGMVRRGGTVALNGLPPGDFPLSIFDTVLNGITVRGSIVGTRLDLLEAL
AFAGDGKVKATVHADKLENINDVFSRMHHGDIEGRIVLDLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaccatgaaggcggcggtcgtccgcgaattcggcaagcccctggtcatcgag
gacgcgccgatcccgacggtcggccccgggcagatcctggtcaagattgcggcaaccggc
gtgtgccataccgacctgcacgcggcagaaggggactggccggtcaaacccaacccgccc
ttcattcctggccatgaaggcgtcgggcatgtcgccgccgtcggtgcgggcgtcacccat
gtgaaggaaggcgaccgggtcggcgtgccctggctctacaccgcctgcgggcattgcgtg
cattgcctgggtggctgggagacgctttgccacgaacagcagaacaccggctattcggtc
aatggcagctttgccgaatatgtcctcgccgatcccaactatgttggtcaccttcccgac
aatgtcgacttcctcgacattgcgccgatcctctgcgcgggcgtcaccgtctacaaggga
ttgaaggccaccgaggcccgacccggcgagtgggtggtcgtctcagggatcggcgggctc
ggccacatggcggtgcaatatgcccgtgccatgggtctcaatgtggccgcggtcgacatc
gacgatagcaagctcgacctcgctacacgccttggcgccacactgacggtcaacgcgcac
agcgaggacccttcggcagcgctcaagaaggcgataggcggcgcgcacggagcgctcgtc
accgccgtttcgcccaaggcgttccagcaggcgctcggcatggtccggcgcggcggcacg
gtcgcgctcaatggtctgccgccgggcgacttcccgctgtcgatcttcgacaccgtgctg
aacggcattaccgtgcgaggctcgatcgtcggcacgcggctcgatctgctcgaggcactg
gcgttcgccggcgacggcaaggtcaaggccacggtccatgcagacaagctggagaacatc
aacgacgtcttctcccgcatgcaccatggcgacatcgagggccggatcgtcctcgacctc
gcctga

DBGET integrated database retrieval system