KEGG   Sphingobium sp. SYK-6: SLG_p_00920Help
Entry
SLG_p_00920       CDS       T01622                                 

Definition
putative thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SLG_p_00920
Enzymes [BR:ssy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SLG_p_00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pSLPG:complement(87683..89221)
Genome map
AA seq 512 aa AA seqDB search
MKPGIIEDAEAEPVATTLRARRIGLSAAGSDLIAVMRHDCPVCRSEGLASRAQVALRAGG
REIVVSLLHSSAETPAPGEIGLSESAWQRLGVSDGDPVEIAHAQPLASLAEVRRRIYGNR
LSDGAFSAIITDIAERRYSDVHLSAFVTACSAVPLDTDETISLTRAMVDVGERLQWPGTV
IVDKHSVGGLPGNRTTPIIVSIMAAEGLIMPKTSSRAITSPAGTADTMEVLAPVDLDVSA
IRKVVEREGGCIAWGGAVNLSPADDVIIGVERVLDIDAVGQMVASVLSKKIAAGATHLVI
DIPVGPTAKVRGADAADTLERALSSVAQAFGLRTRVMRGPGAEPIGRGIGPALEAQDILA
VLQGQPGAEDLAHRACELAGGLLELADAAPAREGYARARACLESGRAWAKFQRICEAQGG
MRAPPVARFQQDMIAPYSGRLVSIDNRKLATVAKLAGAPMAKAAGVALQCRLNQMVDAGA
PLCSIHAESPGELDYAAAYAVSDGPIFGIEAL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgggatcatcgaggacgccgaagcagagcctgtcgcgacgacgctgcgggca
cgccgcatcggcctgtcggctgccggaagcgatctgatcgcggtcatgcgccacgactgt
cccgtctgccgctcggaaggtcttgcgtcccgcgcgcaggtcgcgctgcgcgccggcggg
cgggaaatcgtcgtctcgctgctgcacagctccgcggagactccagcgcccggcgagatc
ggcctctccgaatccgcatggcagcggctcggcgtcagcgatggcgatccggtcgagatc
gcgcacgcccagcctctcgcctcgctcgccgaagtgcgtcggcgcatctatggcaatcgt
ctcagtgacggggctttttcagcgatcatcaccgacatcgccgagcgacgctatagcgat
gtccatctctcggcgttcgtcacggcctgctcagcggtcccgctcgatacggacgaaacg
atcagcctgaccagggcgatggtcgatgtcggcgagcgattgcagtggcccggaacggtc
atcgtcgacaagcatagcgtcggtggcttgccgggcaatcgcaccacgccgatcatcgtc
tcgatcatggccgcggagggcctgatcatgcccaagacatcgtcgcgggcgatcacctca
ccggccggcacggcggacacgatggaggtgctggcacctgtcgacctcgacgtttccgca
atccgcaaggtggtcgagcgcgaaggcggctgcatcgcctggggcggcgccgtcaacctc
agccctgccgacgatgtgatcatcggcgtggaacgggtgctcgatatcgatgccgtcggg
cagatggtcgcctcggtgctgtccaagaaaatcgcggccggtgcgacccatctggtcatc
gacatcccggtcgggccgaccgccaaggtacgcggcgccgatgccgccgacacgctcgag
cgggcgctgagctctgtcgcccaagccttcgggcttcgcacgcgcgtgatgcgcggcccc
ggcgccgagccgatcggacggggcatcggtccggcgctcgaggcgcaggatatccttgcc
gtgctccaggggcagccgggcgccgaggatctcgcccaccgggcctgcgagctggcggga
ggactgcttgagctcgcggacgcagccccggcccgcgaaggttatgcgcgtgcgcgggcg
tgcctcgaaagcggccgggcctgggccaagttccaacgtatctgcgaagcgcagggcggc
atgcgggctccaccggtcgcccggttccaacaggatatgatcgctccctatagcggccgc
ctggtgagtatcgacaatcgcaagctcgcgacggtcgcgaagcttgccggcgcgccgatg
gccaaggccgccggcgtcgcgctgcagtgtcggctgaaccagatggtggatgccggggct
cccttgtgtagcattcatgccgagagcccgggcgagctcgactatgcggcggcctatgcg
gtgagcgacgggccgatcttcgggattgaagcgctatga

DBGET integrated database retrieval system