KEGG   Serratia symbiotica: SCc_061Help
Entry
SCc_061           CDS       T01672                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ssz  Serratia symbiotica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(92200..93036)
Genome map
AA seq 278 aa AA seqDB search
MQLIMRNMTLNLSRPQVMGILNVTLDSFSDGGRYNQLNKALLHANELISAGAAIIDVGGE
STRPGAVEVSEDEEIERIVPIVEALARRFDILISVDTSKAKVMHEAIIAGVHIINDIRSL
QEPGALAIAAKSGLTICLMHMQGQPRTMQQSPHYNNLIADLNIFFKHHIKRCHDVGIKNK
QLLLDPGFGFGKNLAHNYELLARLSEFHHFGLPLMVGMSRKSMIGQLLHVKPDQRIIGSV
ACAVIAAMHGAQIIRVHDVKETVEAMRIVEATLLAKRQ
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaatcatgcgcaacatgacacttaatctctcccgaccacaggtaatgggcatc
cttaatgtaacattagattccttttctgatggtggtcgttataaccagcttaataaagcg
ttattacatgctaacgaactaatttcggctggtgctgccataattgatgtaggtggcgaa
tctacacgaccaggcgcagtagaagttagtgaggatgaagaaattgagcgaatagtgcca
atagtagaggcattagccagacgttttgatatattaatctcagttgacacgtctaaggca
aaagtgatgcacgaagcaataatagcaggagtgcatataattaatgacattcgatcatta
caagaaccaggcgcattagcgattgctgccaaaagtggattaacgatatgcttaatgcac
atgcaagggcaaccacgcactatgcagcaatctccgcattacaataacctcattgctgat
ttaaatatttttttcaagcatcatattaaacgttgccatgatgtcggaataaaaaataaa
caactactactcgatccaggctttggatttggtaaaaatttggcacataattatgaactt
ttagcgcgattatcagaatttcaccactttggtctaccactgatggtgggaatgtcgcga
aaatcaatgatcggacaactgctgcacgttaagcctgatcaacggattatcggtagcgta
gcctgtgcagtaatcgctgcaatgcatggcgcacaaattatccgagtccatgatgttaaa
gaaacagttgaggcgatgcgtatcgtcgaggcaacacttttagctaagagacagtag

DBGET integrated database retrieval system