KEGG   Serratia symbiotica: SCc_118Help
Entry
SCc_118           CDS       T01672                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ssz  Serratia symbiotica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssz00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ssz00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
209977..210462
Genome map
AA seq 161 aa AA seqDB search
MIISLIAALSVEHVIGTGNVMPWHLPSDLIWFKCMTQNKPVIMGRKTFESIGYPLSNRHN
IVLSSRSGSSSGGLTWVNSIDDALDLVKNVKEVMVIGGECIYSQFILRAKRMYLTYIYAS
VSGDIYFPEYKPWEWETIFSEFHNADALNYYSHCFKILERY
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattataagtttgattgccgctttgtcagtggagcatgttattggtacagggaatgta
atgccttggcatcttccttctgatttaatttggtttaaatgtatgacacaaaataagcca
gtaattatggggcgtaagacttttgagtctattgggtacccgttgtcaaaccggcataat
attgtattaagtagtcgttctggtagtagttctggagggcttacttgggtaaattcaata
gatgatgcactggatcttgttaagaatgtaaaagaggtaatggttataggtggtgagtgt
atttatagccagtttatcttacgcgctaaacgtatgtacctaacttatatttatgcgtca
gttagcggggatatttattttccagagtataaaccttgggagtgggaaactatatttagt
gaattccataatgcagatgcactaaattattatagtcattgctttaagatcttggagcgt
tactaa

DBGET integrated database retrieval system