KEGG   Serratia symbiotica: SCc_209Help
Entry
SCc_209           CDS       T01672                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ssz  Serratia symbiotica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCc_209 (dxr)
Enzymes [BR:ssz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SCc_209 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408562..409794
Genome map
AA seq 410 aa AA seqDB search
MVLSGSYSRRLMKQLTILGSTGTVGISTLAVVREHPELFAIKALVAGRNVAVMAQQCMVF
RPTYAAMAYESSARELRIILSENGLDTEVLSGKDAACELAALGDVDQVTAAIVGTAGLLP
TLAAIRAGKQVLLANKEALVTCGRLFMEAVQKSQAQLLPLDSEHNAIFQSLPESIQRQLG
YASLDEHGVSGIVLTGSGGPFLTMPLEQFVTITPYQACAHPNWSMGRKISVDSATMMNKG
LEYIEARWLFNASAKQIEVILHPQSIIHSMVRYTDGSVLAQLGTPDMRTPIAHAIAYPQR
VYSGAEILDFCRIGSLTFAELERERYPCFYLAIEAFDTGQAATTALNAIDEIAVAAFLHK
QIRFTDIAKVNRKVLESLSLQEPSCIDAVLEIDCQARSVASEVVKSMRIF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggttttatcaggcagttattcaaggcggcttatgaagcaattaactattcttggctca
actggtacggtaggtattagcaccttagctgttgtcagagaacatcctgagctttttgcg
attaaggcattggtagctggtcgtaatgtggcagtcatggctcaacagtgtatggtgttt
cgtccaacttatgcggcaatggcgtatgaaagctctgcacgtgaactacgtattattcta
tcagaaaacggtttagatacagaggtactgtcaggtaaagatgcagcctgcgagttagca
gcattaggggatgttgatcaagtaacagcagcaattgtaggtactgctgggctattaccg
acattagcagctattagagcaggtaaacaggtgttattagctaataaagaggcattagta
acttgtgggcgactgtttatggaggctgtgcaaaagagtcaggcacagttactgccatta
gatagcgagcataatgcaatttttcagagcttgcctgaaagtattcagcgccagttagga
tatgcgtcgttggatgagcatggtgtttctggcattgtacttactggttctggcgggcct
tttttaactatgccactagagcagtttgtaacaataaccccatatcaagcatgtgctcac
cctaattggtctatgggtcgtaaaatatcagttgattcggctactatgatgaataaaggt
ctagagtatattgaggctcgctggttatttaatgcgtctgcaaaacaaatagaagtaata
ttgcaccctcaatctataattcattcaatggtacgctacactgatggcagtgtgctagct
cagttgggaaccccagatatgcgcaccccaattgcccatgcgatagcttatccgcagcga
gtttattctggcgcagaaatattggatttttgccgtattggttcattaacttttgctgaa
ttagaacgcgagcgttatccttgtttctatctagcaattgaggcttttgataccgggcag
gcggcaaccactgcattgaatgctatcgacgagattgccgtagcagcgtttttgcataaa
cagattcgttttactgatatcgctaaagttaatcgcaaagtattagagagtttatcatta
caggagccgtcctgtattgatgcagtattagaaatagattgccaagcacgatcagttgcc
agtgaagtagttaaatctatgagaattttttaa

DBGET integrated database retrieval system