KEGG   Serratia symbiotica: SCc_252Help
Entry
SCc_252           CDS       T01672                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ssz  Serratia symbiotica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCc_252 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCc_252 (sucC)
   00640 Propanoate metabolism
    SCc_252 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SCc_252 (sucC)
Enzymes [BR:ssz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCc_252 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
complement(502485..503666)
Genome map
AA seq 393 aa AA seqDB search
MDNNTMYLHEYQTKQLFAKYGIPIPTGYTCTTPNEAEKAASKIGEGPWVVKCQIHAGGRG
IAGGVKLINSKENIRAFAEAKLGQRLVTDQTNAQGQLVHHILVEATTEIDTELYLGAIVD
RNTSRLVFMASTKGGIKVEKITKEYPTLIHKITIDPLVGAQPYQGRVLAFKLGLSGKQIN
YFANIVIKLTKLFLEHDLVMLEVNPLAITKQGELVCLDGKLNADSNALFRQPALLKMRDL
SQKGERESRAIQANLHYVTLNGNIGLMVNGAGLAMATMDVIKLYGGEPANFLDIGGNITN
ERIAEALRIILSDNKVKAVLVNIFGGIVCCNLIADAIISVMTEVDNHIPVIVRLEGNNAK
LGIKKLIYSNLNIIATTSLINVMQQIIKAVRDK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataataatactatgtatttacatgaatatcaaacaaaacagttgtttgctaagtat
ggcatcccaatacctactggatatacatgcactacgcctaatgaagcagaaaaagctgcc
tctaaaattggtgaaggtccatgggtagtaaaatgtcagattcatgctggtggacgaggt
atagctggcggcgttaaattaattaacagtaaagaaaatatccgtgcttttgcagaagct
aaattaggacaacgtctagttacggaccaaactaatgcccagggtcagttagtacaccac
attttagtagaagctactaccgaaatagatacagaactatatttaggtgcaatagttgat
agaaatactagtcgtcttgtatttatggcatctactaaaggcggtattaaggtagaaaaa
ataacaaaagaatatcctacacttatccataaaataactattgatcctttagtaggagca
caaccttatcaaggacgtgtcctggcctttaaattgggtctaagtggtaaacaaattaac
tattttgctaatattgtaatcaaattaacaaaactatttctagaacatgatctagtgatg
cttgaagttaacccactagctatcactaaacaaggggaactagtttgtctagatggtaaa
ctgaatgcggatagtaacgctttattccgccaacctgcattattaaaaatgcgcgatctt
tcccagaagggtgagcgtgaatcccgtgcaatccaggctaatcttcactatgttacactt
aacggtaacattggcttaatggtgaatggtgctggcctagcaatggccaccatggatgta
attaaactatatggcggagagccggccaacttcttagatataggtggtaatataactaac
gaacgaattgctgaagcactgagaatcatcctttcagataataaagtaaaagcagtgcta
gttaatatatttggtggaatcgtatgttgtaatctgattgctgacgcaattatcagcgta
atgactgaagtcgataatcatataccagtaattgtaaggctagaaggtaataatgccaag
ttaggcattaaaaaattaatatatagtaacctaaatattattgctacgactagtttaatt
aatgtgatgcagcaaattattaaagcggtccgggataaatga

DBGET integrated database retrieval system