KEGG   Serratia symbiotica: SCc_275Help
Entry
SCc_275           CDS       T01672                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ssz  Serratia symbiotica
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCc_275 (folK)
Enzymes [BR:ssz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SCc_275 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(551653..552135)
Genome map
AA seq 160 aa AA seqDB search
MFRAYIALGSNLANPLQQVNTAIKALQQLPCSKFITCSLFYRSRPMGPQNQPDFLNAVVA
IDTLLQPEQLLNCTQYIERRQGRILQHERWGPRPIDLDIMLYGNQVINTARLIVPHYGMQ
EREFMLYPLAEIAPDITFPDGRPLIKRLKYLPKNEIVLWS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtgcttatattgctctaggtagtaacttagcaaatccactacaacaagttaat
actgctataaaggcactacagcaactaccgtgtagtaaatttattacttgttctttgttc
taccgctcgagacctatggggccacaaaaccaaccagactttctaaacgcggtggtagca
atagataccttattacaacccgaacaactacttaactgcactcagtacatagaacgccgt
caaggacgcatacttcagcatgaacgctggggaccacgccctattgatttagatataatg
ctatatggtaatcaagttattaacactgctcggctcatagtaccacattatggtatgcaa
gaacgtgagtttatgctctatccacttgctgaaatagctccagatatcacttttccagat
ggtcgaccacttattaaacgcctaaaatatctaccaaaaaacgaaattgtactctggagt
taa

DBGET integrated database retrieval system