KEGG   Serratia symbiotica: SCc_296Help
Entry
SCc_296           CDS       T01672                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssz  Serratia symbiotica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCc_296 (gpmA)
   01230 Biosynthesis of amino acids
    SCc_296 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCc_296 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SCc_296 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCc_296 (gpmA)
Enzymes [BR:ssz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SCc_296 (gpmA)
Exosome [BR:ssz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SCc_296 (gpmA)
  Exosomal proteins of melanoma cells
   SCc_296 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(595535..596287)
Genome map
AA seq 250 aa AA seqDB search
MAATKLVMVRHGESQWNYENRFTGWHDVDLSDKGHAEAQDAGNLLQKKGFSFDFAYTSVL
KRAIHTLWHILDALDQTWLPSEKSWRLNERHYGALQGLNKAETAKKYGNEQVKQWRRSFT
ALPPKLTTEDERYPGHDPRYNMLARHKLPLSESLALTINRVIPYWDAEILPKLKNNERII
IVAHGNSLRALIKYLDNLNEKEILELNIPTGIPLVYEFDNAFKPRNHYYLGSAAEIAAKS
AAVAAQGTDE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaactaagcttgtcatggtacgacatggtgaaagccaatggaattatgaaaat
cgctttactggttggcatgatgttgatttatctgataaaggccatgctgaagcacaagac
gcgggtaatttattacaaaaaaaaggcttttcttttgactttgcatatacttctgtctta
aaacgtgcaatccacactttatggcatatcctcgatgcactagaccaaacctggctacct
agtgaaaaatcatggagactaaatgagcgtcattatggagccctacaaggcttaaataaa
gcagaaactgctaagaaatatggtaatgaacaagttaaacaatggcgtcgtagctttact
gcacttccgcccaaattaactacagaagacgaacgctatccaggtcacgaccctcgatac
aatatgctagctagacacaaacttccgttatccgaaagcttagcactaactattaaccgc
gttattccatactgggacgcagagattttaccaaaacttaagaacaacgagcgcattata
attgtagctcacggcaactctctacgagcactaataaaatacctagataacttaaatgaa
aaagagatattggaattaaatattccaactggaataccattagtgtatgaatttgataac
gcttttaagccaaggaatcattactacttaggtagtgctgccgagatcgcagctaaatca
gctgccgtagcagcccaaggcacagatgaataa

DBGET integrated database retrieval system