KEGG   Serratia symbiotica: SCc_332Help
Entry
SCc_332           CDS       T01672                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssz  Serratia symbiotica
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssz01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ssz00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(690821..691948)
Genome map
AA seq 375 aa AA seqDB search
MICPVIKLAQQLIKRPSISPHDAGCQKLLLTRLKAIGFNIEMMNFNDTQNFWAWHGYGST
IAFAGHTDVVSVGDEKNWYYPPFEPTICDGILYGRGAADMKGSLAAMVVAAERFITTNAI
HRGRLAFLITSDEEASAANGTVKVVEALMARNEKLDYCLVGEPSSAERIGDIIKNGRRGS
ITANILIYGIQGHVAYPHLIHNPIHRAIPALNELVTIQWDYGNAFFPPTSMQITNITAGT
ESNNVTPDQLLLQCNFRFNPDITEALLKQRIETLLQHHKLHYKIDWHLSGYPFLTRRGVL
LDAVVNSIEHYAKLTPKILTTGGTSDGRFIAQMGAQVVELGPVNTTIHMVNECVNVADLQ
LLSKIYQRIIEQLLL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcccagttattaaacttgctcaacaattaattaaacgaccttctattagcccg
catgacgcaggatgccaaaaattattacttacgcgccttaaagcaatcgggtttaatatt
gagatgatgaattttaatgacactcagaacttttgggcatggcatggatatggcagcact
atagcatttgctggccatactgatgttgtatcagtaggtgatgaaaaaaactggtattat
ccaccatttgaaccaactatctgcgatggtatcttgtacggacgtggcgccgcagatatg
aaaggatcattagcagcgatggtcgtggctgcagagcgctttattactaccaatgcaatt
catcgaggccggttagcatttttaattacttctgatgaagaggctagtgctgctaatggc
acggtcaaggtagtggaagcgcttatggcgcgcaatgagaaattagattactgtttagtc
ggtgaaccatctagcgctgagcgcattggagatataataaaaaacggacgtcgaggctca
attactgcaaatatacttatttatggcattcagggtcatgttgcttacccgcatcttata
cacaacccaatacaccgtgctataccagcgctcaatgaattagtgactattcaatgggat
tacggtaacgcattctttccgccaactagcatgcagattactaatatcacagctggtacc
gaaagtaataatgtaacccctgatcaactattattacaatgtaactttcgttttaatcct
gatataactgaagcactgcttaaacagcgcatcgaaacattattacaacatcataaacta
cactataaaatcgattggcatctatctggatatcctttccttactcgtcgtggggtacta
ctagacgctgtagtaaactcaattgaacactatgcaaaattaacaccaaaaatactaact
acaggaggtacctcggatggtcgatttatcgctcagatgggggcacaagtagtagaactg
gggccagtaaacactactattcatatggttaacgaatgtgtaaatgttgctgatctacaa
ctattgagtaaaatttaccaacgtataatagaacaacttcttttatag

DBGET integrated database retrieval system