KEGG   Serratia symbiotica: SCc_334Help
Entry
SCc_334           CDS       T01672                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssz  Serratia symbiotica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCc_334 (galU)
   00052 Galactose metabolism
    SCc_334 (galU)
   00500 Starch and sucrose metabolism
    SCc_334 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SCc_334 (galU)
Enzymes [BR:ssz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCc_334 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
Position
697488..698450
Genome map
AA seq 320 aa AA seqDB search
MVYKSHKMGMLIGETMLAVNRKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYV
VNECVMAGIIEIVLVTHSSKNSIENHFDTSFELEAILEKRVKRQLLDEVQSICPKDVTVM
QVRQGMAKGLGHAIMCAYPMVGDEPVVVVLPDVILDEYSVELKKDNLYEMLRRFSMTGIS
QIMVEPVPYKDVENYGIVDCQGYDLHPGESAPMVSVIEKPIPNRAPSNLAIVGRYVLSAN
IWPFLSKTSTGVGDEIQLTDSIEMLMQQETVEAYRLKGMSYDCGNKLGYMQAFVQYGMRH
ASLGKDFSKWLKLLITTAKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtatataaatctcataaaatgggtatgttgataggggaaacaatgctcgctgtaaat
cgtaaggtcaggaaagcggtaattccagttgcagggctaggaacacggatgttgccggca
actaaagctattccaaaagaaatgttacctctagtggacaaacccttaattcagtatgtg
gtaaatgaatgtgttatggctggaattatcgagatcgtactagttactcattcctctaaa
aactcaattgagaatcattttgatactagttttgaattagaagcaatactagaaaaacgt
gttaagcgccaattgttagacgaagtacagtcaatttgccctaaggacgttacagtaatg
caggttcgtcagggaatggctaagggattggggcatgcaattatgtgtgcgtatccgatg
gtaggagatgaaccagttgttgtggtattaccggatgtcatattagacgaatatagtgtt
gagctaaaaaaagacaatttatatgaaatgttacgacgtttttctatgacgggcattagc
cagattatggtagaacctgtgccatataaagatgttgagaattacggtattgtagattgc
cagggctatgatctgcatcctggggagagtgctccaatggttagcgtaattgaaaaacct
atacctaacagagctccttctaatttagccattgtagggcgttatgtgttatctgctaat
atttggccatttttatcaaaaacatctacaggtgttggcgacgaaatacaattaacagat
agcattgaaatgctcatgcagcaggagacggtagaagcttatcgattgaaaggtatgagc
tatgattgcggcaataagttgggctatatgcaagcttttgtgcaatatgggatgcgtcac
gctagcctaggtaaagatttttctaagtggttaaaattattgataactacggcaaagaaa
taa

DBGET integrated database retrieval system