KEGG   Serratia symbiotica: SCc_334Help
Entry
SCc_334           CDS       T01672                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssz  Serratia symbiotica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ssz00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssz00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssz00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssz00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
697488..698450
Genome map
AA seq 320 aa AA seqDB search
MVYKSHKMGMLIGETMLAVNRKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYV
VNECVMAGIIEIVLVTHSSKNSIENHFDTSFELEAILEKRVKRQLLDEVQSICPKDVTVM
QVRQGMAKGLGHAIMCAYPMVGDEPVVVVLPDVILDEYSVELKKDNLYEMLRRFSMTGIS
QIMVEPVPYKDVENYGIVDCQGYDLHPGESAPMVSVIEKPIPNRAPSNLAIVGRYVLSAN
IWPFLSKTSTGVGDEIQLTDSIEMLMQQETVEAYRLKGMSYDCGNKLGYMQAFVQYGMRH
ASLGKDFSKWLKLLITTAKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtatataaatctcataaaatgggtatgttgataggggaaacaatgctcgctgtaaat
cgtaaggtcaggaaagcggtaattccagttgcagggctaggaacacggatgttgccggca
actaaagctattccaaaagaaatgttacctctagtggacaaacccttaattcagtatgtg
gtaaatgaatgtgttatggctggaattatcgagatcgtactagttactcattcctctaaa
aactcaattgagaatcattttgatactagttttgaattagaagcaatactagaaaaacgt
gttaagcgccaattgttagacgaagtacagtcaatttgccctaaggacgttacagtaatg
caggttcgtcagggaatggctaagggattggggcatgcaattatgtgtgcgtatccgatg
gtaggagatgaaccagttgttgtggtattaccggatgtcatattagacgaatatagtgtt
gagctaaaaaaagacaatttatatgaaatgttacgacgtttttctatgacgggcattagc
cagattatggtagaacctgtgccatataaagatgttgagaattacggtattgtagattgc
cagggctatgatctgcatcctggggagagtgctccaatggttagcgtaattgaaaaacct
atacctaacagagctccttctaatttagccattgtagggcgttatgtgttatctgctaat
atttggccatttttatcaaaaacatctacaggtgttggcgacgaaatacaattaacagat
agcattgaaatgctcatgcagcaggagacggtagaagcttatcgattgaaaggtatgagc
tatgattgcggcaataagttgggctatatgcaagcttttgtgcaatatgggatgcgtcac
gctagcctaggtaaagatttttctaagtggttaaaattattgataactacggcaaagaaa
taa

DBGET integrated database retrieval system