KEGG   Serratia symbiotica: SCc_334Help
Entry
SCc_334           CDS       T01672                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssz  Serratia symbiotica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCc_334 (galU)
   00052 Galactose metabolism
    SCc_334 (galU)
   00500 Starch and sucrose metabolism
    SCc_334 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SCc_334 (galU)
Enzymes [BR:ssz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCc_334 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
697488..698450
Genome map
AA seq 320 aa AA seqDB search
MVYKSHKMGMLIGETMLAVNRKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYV
VNECVMAGIIEIVLVTHSSKNSIENHFDTSFELEAILEKRVKRQLLDEVQSICPKDVTVM
QVRQGMAKGLGHAIMCAYPMVGDEPVVVVLPDVILDEYSVELKKDNLYEMLRRFSMTGIS
QIMVEPVPYKDVENYGIVDCQGYDLHPGESAPMVSVIEKPIPNRAPSNLAIVGRYVLSAN
IWPFLSKTSTGVGDEIQLTDSIEMLMQQETVEAYRLKGMSYDCGNKLGYMQAFVQYGMRH
ASLGKDFSKWLKLLITTAKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtatataaatctcataaaatgggtatgttgataggggaaacaatgctcgctgtaaat
cgtaaggtcaggaaagcggtaattccagttgcagggctaggaacacggatgttgccggca
actaaagctattccaaaagaaatgttacctctagtggacaaacccttaattcagtatgtg
gtaaatgaatgtgttatggctggaattatcgagatcgtactagttactcattcctctaaa
aactcaattgagaatcattttgatactagttttgaattagaagcaatactagaaaaacgt
gttaagcgccaattgttagacgaagtacagtcaatttgccctaaggacgttacagtaatg
caggttcgtcagggaatggctaagggattggggcatgcaattatgtgtgcgtatccgatg
gtaggagatgaaccagttgttgtggtattaccggatgtcatattagacgaatatagtgtt
gagctaaaaaaagacaatttatatgaaatgttacgacgtttttctatgacgggcattagc
cagattatggtagaacctgtgccatataaagatgttgagaattacggtattgtagattgc
cagggctatgatctgcatcctggggagagtgctccaatggttagcgtaattgaaaaacct
atacctaacagagctccttctaatttagccattgtagggcgttatgtgttatctgctaat
atttggccatttttatcaaaaacatctacaggtgttggcgacgaaatacaattaacagat
agcattgaaatgctcatgcagcaggagacggtagaagcttatcgattgaaaggtatgagc
tatgattgcggcaataagttgggctatatgcaagcttttgtgcaatatgggatgcgtcac
gctagcctaggtaaagatttttctaagtggttaaaattattgataactacggcaaagaaa
taa

DBGET integrated database retrieval system