KEGG   Serratia symbiotica: SCc_334Help
Entry
SCc_334           CDS       T01672                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssz  Serratia symbiotica
Pathway
ssz00040  Pentose and glucuronate interconversions
ssz00052  Galactose metabolism
ssz00500  Starch and sucrose metabolism
ssz00520  Amino sugar and nucleotide sugar metabolism
ssz01100  Metabolic pathways
ssz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCc_334 (galU)
   00052 Galactose metabolism
    SCc_334 (galU)
   00500 Starch and sucrose metabolism
    SCc_334 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SCc_334 (galU)
Enzymes [BR:ssz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCc_334 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEW44486
UniProt: R4I0Y9
Position
697488..698450
Genome map
AA seq 320 aa AA seqDB search
MVYKSHKMGMLIGETMLAVNRKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYV
VNECVMAGIIEIVLVTHSSKNSIENHFDTSFELEAILEKRVKRQLLDEVQSICPKDVTVM
QVRQGMAKGLGHAIMCAYPMVGDEPVVVVLPDVILDEYSVELKKDNLYEMLRRFSMTGIS
QIMVEPVPYKDVENYGIVDCQGYDLHPGESAPMVSVIEKPIPNRAPSNLAIVGRYVLSAN
IWPFLSKTSTGVGDEIQLTDSIEMLMQQETVEAYRLKGMSYDCGNKLGYMQAFVQYGMRH
ASLGKDFSKWLKLLITTAKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtatataaatctcataaaatgggtatgttgataggggaaacaatgctcgctgtaaat
cgtaaggtcaggaaagcggtaattccagttgcagggctaggaacacggatgttgccggca
actaaagctattccaaaagaaatgttacctctagtggacaaacccttaattcagtatgtg
gtaaatgaatgtgttatggctggaattatcgagatcgtactagttactcattcctctaaa
aactcaattgagaatcattttgatactagttttgaattagaagcaatactagaaaaacgt
gttaagcgccaattgttagacgaagtacagtcaatttgccctaaggacgttacagtaatg
caggttcgtcagggaatggctaagggattggggcatgcaattatgtgtgcgtatccgatg
gtaggagatgaaccagttgttgtggtattaccggatgtcatattagacgaatatagtgtt
gagctaaaaaaagacaatttatatgaaatgttacgacgtttttctatgacgggcattagc
cagattatggtagaacctgtgccatataaagatgttgagaattacggtattgtagattgc
cagggctatgatctgcatcctggggagagtgctccaatggttagcgtaattgaaaaacct
atacctaacagagctccttctaatttagccattgtagggcgttatgtgttatctgctaat
atttggccatttttatcaaaaacatctacaggtgttggcgacgaaatacaattaacagat
agcattgaaatgctcatgcagcaggagacggtagaagcttatcgattgaaaggtatgagc
tatgattgcggcaataagttgggctatatgcaagcttttgtgcaatatgggatgcgtcac
gctagcctaggtaaagatttttctaagtggttaaaattattgataactacggcaaagaaa
taa

DBGET integrated database retrieval system